SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F0SUR8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F0SUR8
Domain Number 1 Region: 4-234
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.94e-34
Family Methylenetetrahydrofolate reductase 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F0SUR8
Sequence length 247
Comment (tr|F0SUR8|F0SUR8_SYNGF) Methylenetetrahydrofolate reductase {ECO:0000256|RuleBase:RU003862} KW=Complete proteome; Reference proteome OX=645991 OS=Syntrophobotulus glycolicus (strain DSM 8271 / FlGlyR). GN=Sgly_2346 OC=Syntrophobotulus.
Sequence
MNKIAVELVPRDERSLISELSLINSRFPLIKTINFPDLLRFDLRSWEGCRIAQRYFQDVI
PHIRAMDIKLSDELPMQGFLIEHKINQVLVVTGDLPQDMTKKIYPSTSIEVIKKFKREMP
GIKVYAAVDPYRKSVREELEYIRRKLEAGADGFFTQPFFDLRLMEIYAEILDGCEVFWGI
SPVTGEKSVNYWETKNNVVFPRGFEPTLKWNVNFAKQALALTESRKDNIYFMPIRTGLEE
YLRGIFG
Download sequence
Identical sequences F0SUR8
gi|325290454|ref|YP_004266635.1| WP_013625499.1.55828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]