SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F1LRA5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1LRA5
Domain Number 1 Region: 799-934,994-1060
Classification Level Classification E-value
Superfamily Hemopexin-like domain 7.46e-40
Family Hemopexin-like domain 0.00072
Further Details:      
 
Domain Number 2 Region: 68-108
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000275
Family Somatomedin B domain 0.0011
Further Details:      
 
Domain Number 3 Region: 27-67
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000824
Family Somatomedin B domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1LRA5
Sequence length 1060
Comment (tr|F1LRA5|F1LRA5_RAT) Proteoglycan 4 {ECO:0000313|Ensembl:ENSRNOP00000059900} KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Prg4 OC=Muroidea; Muridae; Murinae; Rattus.
Sequence
MGWKILPICLSMLLPVFLIQQVSSQDISSCAGRCGEGYSRDATCNCDYNCQHYMECCPDF
KRVCTTELSCKGRCFESFARGRECDCDSQCKQYGKCCADYNSFCEEVHNPTSPPPKTAPP
PPGASRTIKSTTKRSPKSPKKKTKKVVESEEITEEHSVSENQESSSSSSSSSSTIRKIKS
SKNSANRELQKNPKVKDNKKNTPKKKPNPEPPVVDEAGSGLDNGEPKLTPPPDPPTPHNK
VTASPKTTAAKPVTPKPSLAPNSETSKEASSTSNKETTVETKETTETNKQSSASKKEKTT
SAKETRSAENTSAKDVEPTSTTPKNSAPTTTKKPVTTTKEPVPTTTKGPEPTSKEPAPTT
PKEPELTIPKEPAPTTKKPAPTTPKEPAPTTPKEPAPTTPKEPAPTTPKEPALTTPKEPA
PTPKEPEPTTPKEPEPTTPKEPAPTTPKEPAPTTKKPELTIPKEPVPTTPKEPAPTTPKE
PAPTTTKKPELSTPKEPTSTNPKEPEPTLPKEPELTLPEEPEPSNPETSDELIAELAEAP
TPKALENNPKEPTVPTETPEVSKPEMTTAKEKTTEKDTTQTTTTVTPKTTTETTIIPEET
TEPRASTTTRITSTAQDTTSPQMTTLKATTLAAKVTAPTEEIQSKPEETTLTTPALEGSD
ASKTTLKPQKPTKAPKKPASTKKPTKAPKKPTSTKKPKTPKGRKPKTTPSPLKTSTMSEQ
NTTPLEVMLPTTTVPKQTPNSETAEVNPAHEDADGGEGEKPLIPRPPVLSPTAVPGTDLL
VERLNPGINIHPMFSDETNICNGKPVDGLTTLRNGTLVAFRGHYFWMLNPFRPPSPPRRI
TEVWGIPSPIDTVFTRCNCEGKTFFFKDSQYWRFTNDVMDAGYPKLIVKGFGGLTGKIVA
ALSIAKYKDRPESVYFFKRGGNIQQYTYKQEPVRKCTGRQPAINYSVYGQAAQVRRRRFE
RAVGPFQTHTFRIHYSVPIKASYQDKGFLHNEVKVSTLWRGFPNVVTSAITLPNIRKPDG
YDYYAFSKDQYYNIDVPTRTARAITTRSGQTLSRVWYNCP
Download sequence
Identical sequences F1LRA5
ENSRNOP00000059900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]