SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F1MDE1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MDE1
Domain Number 1 Region: 623-878
Classification Level Classification E-value
Superfamily YWTD domain 8.63e-57
Family YWTD domain 0.00000308
Further Details:      
 
Domain Number 2 Region: 9-271
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-55
Family YWTD domain 0.00000146
Further Details:      
 
Domain Number 3 Region: 322-568
Classification Level Classification E-value
Superfamily YWTD domain 1.14e-49
Family YWTD domain 0.00000336
Further Details:      
 
Domain Number 4 Region: 926-1185
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-39
Family YWTD domain 0.0000435
Further Details:      
 
Domain Number 5 Region: 880-927
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000628
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 1316-1354
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000746
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 578-625
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000838
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 8 Region: 1238-1276
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 1278-1314
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 10 Region: 274-316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000479
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 11 Region: 1195-1248
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000542
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1MDE1
Sequence length 1604
Comment (tr|F1MDE1|F1MDE1_BOVIN) Low-density lipoprotein receptor-related protein {ECO:0000256|PIRNR:PIRNR036314} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=LRP6 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
FSLFVLAAPLLLYANRRDLRLVDAANGKENATIVVGGLEDAAALDFVFSHGLIYWSDVSE
EAIKRIEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVL
FWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSDRFVIINTEIYWPNGLTLDYE
ERKLYWADAKLNFIHRSNLDGTNRVTRQAVVKGSLPHPFALTLFEDTLYWTDWNTHSILA
CNKYTGEGLREIHSNIFSPMDIHVFSQQRQPNATNPCGIDNGGCSHLCLMSPVKPFYQCA
CPTGVTLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIAIDYDP
VEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWTDTGTDRIEV
TRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSDRVVLVNTSL
GWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTD
WQRRSIERVHKRSAEREVIIDQLPDLMGLKATNVHRVIGSNPCAEDNGGCSHLCLYRPQG
LRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDF
DVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRI
EVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERTTLVPN
VGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTD
WSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPV
GGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRA
IDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPNQNLEIQPYDLSIDIYSRYIY
WTCEATNVINVTRLDGRSIGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALD
GTEREVLFFSGLSKPVALALDSRLGKLFWADSDLRRIESSDLSGANRIVLEDTNILQPVG
LTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQEYRQHPCAQ
DNGGCSHICLVKGDGTTRCSCPMHLVLLQDELLCGEPPTCSPQQFTCFTGEIDCIPVAWR
CDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEKNCEVLCLID
QFRCANGQCIGKHKKCDHNLDCSDKSDELDCYPTEEPAPQATNTVGSVIGVIVTIFVSGT
IYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSL
SIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSP
STHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVVTAKGYTSDLNYDSEPVPP
PPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences F1MDE1
ENSBTAP00000053723 ENSBTAP00000053723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]