SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F1MDF8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MDF8
Domain Number 1 Region: 7-242
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.86e-84
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000183
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1MDF8
Sequence length 247
Comment (tr|F1MDF8|F1MDF8_BOVIN) Uncharacterized protein {ECO:0000313|Ensembl:ENSBTAP00000050785} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN= OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
VPANRQRELSLKADDHSRIRLKSENSHSSSDYINASPIMDHDPRKPAYIATQGPLPSTVA
DFWQMVWESGCVVVVMLTPLAENGVRQCYRYWPDEGSSLYHIYEVHLVSEHIWCEDFLVR
SFYLKNLQTSETRTVTQFHFLSWYDQGVPSSTRSLLDFRRKVNKCFRGRSCPIIVHCSDG
AGRSGTYVLIDMVLNKMAKGAKEIDIAATLEHLRDQRPGMVQTKEQFEFALTAVAEEVNA
ILKAFPQ
Download sequence
Identical sequences F1MDF8
ENSBTAP00000050785 ENSBTAP00000050785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]