SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F1MJS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MJS5
Domain Number 1 Region: 523-849
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 6.41e-75
Family Hect, E3 ligase catalytic domain 0.00015
Further Details:      
 
Domain Number 2 Region: 172-370
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.11e-41
Family APC10-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1MJS5
Sequence length 861
Comment (tr|F1MJS5|F1MJS5_BOVIN) HECT domain E3 ubiquitin protein ligase 3 {ECO:0000313|Ensembl:ENSBTAP00000025307} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=HECTD3 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MAGPGPGAALESPRQLLGRVRFLAEAAKSLRAGRPLPAALAFVPREVLYKLYKDPAGPSR
VLLPVWEAEGLGLRVGATGPAPGTGSGALRAARDSIELRRGACVRTTGEELCNGHGLWVK
LTKEQLAEHLGDCGLDEGWLLVCRPAEGGARLVPIDTPDHLQRQQQLFGVDYRPVLRWEQ
VVDLTYSHRLGSRPQPAEAYTEAVQRLLYVPPTWTYECDEDLIHFLYDHLGKEDENLGSV
KQYVESIDVSSYTEEFNVSCLTDSNADTYWESDGSQCQHWVRLTMKKGTIVKKLLLTVDT
TDDNFMPKRVVVYGGEGDNLKKLSDVSIDETLIGDVCVLEDMTVHLPIIEIRIVECRDDG
IDVRLRGVKIKSSRQRELGLNADLFQPTNLVRYPRLEGTDPEVLYRRAVLLQRFIKILDS
VLHHLVPAWDHTLGTFSEIKQVKQFLLLSRQRPGLVAQCLRDSESSKPSFMPRLYINRRL
AMEHRACPLRDPACKNAVFTQVYEGLKPSDKYEKPLDYRWPMRYDQWWECKFIAEGIIDQ
GGGFRDSLADMSEELCPSSADTPVPLPFFVRTANQGNGTGEARDMYVPNPSCRDFAKYEW
IGQLMGAALRGKEFLVLALPGFVWKQLSGEEVSWSKDFPAVDSVLVKLLEVMEGMDKETF
EFKFGKELTFTTVLSDQQVVELIPGGSGIVVGYEDRSRFIQLVQKARLEESKEQVAAMQA
GLLKVVPQAVLDLLTWQELEKKVCGDPEVTVDALRKLTRFEDFEPSDTRVQYFWEALNNF
TNEDRSRFLRFVTGRSRLPARIYIYPDKLGYETTDALPESSTCSSTLFLPHYASAKVCEE
KLRYAAYNCVAIDTDMSPWEE
Download sequence
Identical sequences F1MJS5 L8IPJ1
ENSBTAP00000025307 XP_005894252.1.15283 XP_011987144.1.54773 XP_017898995.1.57651 ENSBTAP00000025307 9913.ENSBTAP00000025307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]