SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F1MP46 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MP46
Domain Number 1 Region: 404-433,467-571,693-808
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.15e-55
Family Phosphate binding protein-like 0.0000000789
Further Details:      
 
Domain Number 2 Region: 40-389
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.18e-22
Family L-arabinose binding protein-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1MP46
Sequence length 1242
Comment (tr|F1MP46|F1MP46_BOVIN) Glutamate ionotropic receptor NMDA type subunit 2C {ECO:0000313|Ensembl:ENSBTAP00000015137} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=GRIN2C OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
VPTLLSPQDSPVDMGVALGPALLLTSLLGAWAGLGPGQGEQTVTVAVVFGSSGSPQAQAR
TRLTPQSFLDLPLEIQPLSVGINNTNPSSLLTQICGLLGAARVHGIVFEDNVGTEAVAQI
LDFISSQTHVPILSISGGSAVVLTPKESGSAFLQLGVSLEQQLQVLFKVLEEYDWSAFAV
ITSLHPGHALFLEGVRAVTDASYLSWRLLDVLTLELGPGGARQHTQRLLRQLDAPVLVAY
CSREEAEVLFAEAAQAGLVGPGHVWLVPSLALGSTDTPPAAFPVGLISVVTESWRLSLRQ
KVRDGVAILALGAHGYRRQHGALPAPAGDCRAHPGPLSPAREAFYRHLLNVTWEGRDFSF
GPGGYLVQPTMVVIALNRHRLWEMVGRWDHGILHMKYPVWPRYSASLQPVVDSRHLTVAT
LEERPFVIVESPDPGTGGCVPNTVPCRRQSNHTFSSSGDAAPYTKLCCKGFCIDILKKLA
RVVRFSYDLYLVTNGKHGKRVRGVWNGMIGEVYYKRADMAIGSLTINEERSEIVDFSVPF
VETGISVMVARSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAITVFMFEYFSPVSYNQNL
TSGKRSGGPSFTIGKSVWLLWALVFNNSVPIENPRGTTSKIMVLVWAFFAVIFLASYTAN
LAAFMIQEQYIDTVSGLSDKKFQRPQDQYPPFRFGTVPNGSTERNIRSNYRDMHTHMVKF
NQRSVEDALTSLKMGKLDAFIYDAAVLNYMAGKDEGCKLVTIGSGKVFATTGYGIAMQKD
SHWKRAIDLALLQFLGDGETQKLETVWLSGICQNEKNEVMSSKLDIDNMAGVFYMLLVAM
GLALLVFAWEHLVYWKLRHSVPNTSRLDFLLAFSRGIYSCFSGVQSLASPARPPSPDLTA
GSAQASVLKMLQAARDMVTTAGVSSSLDRATRTIESWGCGRPAPAPPPACPGPRPPTPAP
PREPSPTGWRPPGGGRAALGRRAAQPSGRPPTPRPALPDVSREASRRAWEARWPLRPGRR
GRRFSASERRARPERPLSPERGHYSSFPRADRSGRPFLPLFPEPPEPEDLPLLGPEQLAR
REALLRAAWARGSRPRHASLPSSVAEAFTRPSSGPARCARPACGRLIPAQSMRLPSYREA
CQEGLWAGPPAWPHGQHTCLHAHAHLPLCWGVVCSHLPPCAAHGPWLPGAWGPPGHRDRT
LGLSPEYSNSGELERVSRAASGTHGFPRPCTWRRISSLESEV
Download sequence
Identical sequences F1MP46
ENSBTAP00000015137 ENSBTAP00000015137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]