SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F1MR40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MR40
Domain Number 1 Region: 418-447,481-585,707-814
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.46e-53
Family Phosphate binding protein-like 0.000000135
Further Details:      
 
Domain Number 2 Region: 52-412
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.81e-26
Family L-arabinose binding protein-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1MR40
Sequence length 993
Comment (tr|F1MR40|F1MR40_BOVIN) Glutamate ionotropic receptor NMDA type subunit 2D {ECO:0000313|Ensembl:ENSBTAP00000040185} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=GRIN2D OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MRGAGGPRGPRGPAKMLLLLALACASPFPEEVPGPGGPAGGGPGGARPLNVALVFSGPAY
ATEAARLGPAVAAAVRSPGLDVRPVALVLNGSDPRSLVLQLCDLLSGLRVHGVVFEDDSR
APAVAPILDFLSAQTSLPIVAVHGGAALVLTPKEKGSTFLQLGSSTEQQLQVIFEVLEEY
DWTSFVAVTTRAPGHRAFLSYIEVLTDGSLVGWEHRGALTLDPGAGEAVLSAQLRSVSAQ
IRLLFCAREEAEPVFRAAEEAGLTGPGYVWFMVGPQLAGGGGSGAPGEPPLLPGGAPLPA
GLFAVRSAGWRDDLARRVAAGVAVVARGAQALLRDYGFLPELGHDCRAQNRTHRGESLHR
YFMNITWDNRDYSFNEDGFLVNPSLVVISLTRDRTWEVVGSWEQQTLRLKYPLWSRYGRF
LQPVDDTQHLTVATLEERPFVIVEPADPISGTCIRDSVPCRSQLNRTHSPPPDAPRPEKR
CCKGFCIDILKRLAQTIGFSYDLYLVTNGKHGKKIDGVWNGMIGEVFYQRADMAIGSLTI
NEERSEIVDFSVPFVETGISVMVARSNGTVSPSAFLEPYSPAVWVMMFVMCLTVVAVTVF
IFEYLSPVGYNRSLATGKRPGGSTFTIGKSIWLLWALVFNNSVPVENPRGTTSKIMVLVW
AFFAVIFLASYTANLAAFMIQEEYVDTVSGLSDRKFQRPQEQYPPLKFGTVPNGSTEKNI
RSNYPDMHSYMVRYNQPRVEEALTQLKAGKLDAFIYDAAVLNYMARKDEGCKLVTIGSGK
VFATTGYGIALHKGSRWKRPIDLALLQFLGDGAAARRDAWGVGWGAGAGEGKWRRXLLLP
RSLQGMYSCCSAEAAPPPAKPPPPPQPLPSPVYPAARPPPGPAPFVPRERAAVDRWRRPK
GAGPPGGAGLADGFHRYYGPIEPQGLGVGEARAAPRGATGRPLSPPTTQPPQKPPPSYFA
IVRDKEPAEPPAGAFPGFPSPPAPPAAAATAVG
Download sequence
Identical sequences F1MR40
ENSBTAP00000040185 ENSBTAP00000040185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]