SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F1MUK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1MUK3
Domain Number 1 Region: 147-226
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.96e-24
Family Thyroglobulin type-1 domain 0.0000142
Further Details:      
 
Domain Number 2 Region: 63-105
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000596
Family Growth factor receptor domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F1MUK3
Sequence length 237
Comment (tr|F1MUK3|F1MUK3_BOVIN) Insulin-like growth factor-binding protein 6 {ECO:0000313|Ensembl:ENSBTAP00000028615} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=IGFBP6 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MTPHRLLPPLLLTLLLAARPGGALARCPGCGQGVSAGCPGGCAEEEDGGPAAEGCAEAGG
CLRREGQQCGVYTPNCAPGLQCQPPEKEDLPLRALLQGRGRCGRARTPSGENPKESKPQA
GTARSQDVNRRDQQRNSGTSTTPSRSNSGGVQDTEMGPCRKHLDSVLQQLQTEVFRGAHT
LYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGQPLPGSSEGGDGSSLCPTGSSG
Download sequence
Identical sequences F1MUK3
ENSBTAP00000028615 XP_010856199.1.44457 ENSBTAP00000028615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]