SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F1N7K8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1N7K8
Domain Number 1 Region: 33-519
Classification Level Classification E-value
Superfamily ALDH-like 3.67e-143
Family ALDH-like 0.000000432
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1N7K8
Sequence length 537
Comment (tr|F1N7K8|F1N7K8_BOVIN) Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial {ECO:0000313|Ensembl:ENSBTAP00000024584} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=ALDH6A1 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MAAVAVAAAAAALRARILQVSSKVNSSWQPASSFSSSSVPTVKLFIDGKFIESKSDKWID
IHNPATNEVIGRVPESTKAEMDAAVSSCKRTFPAWADTSILSRQQVLLRYQQLIKENLKE
IARLITLEQGKTLADAEGDVFRGLQVVEHACSVTSLMLGETMPSITKDMDLYSYRLPLGV
CAGIAPFNFPAMIPLWMFPMAMVCGNTFLMKPSERVPGATMLLAKLFQDSGAPDGTLNII
HGQHEAVNFICDHPDIKAISFVGSNQAGEYIFERGSRHGKRVQANMGAKNHGVVMPDANK
ENTLNQLVGAAFGAAGQRCMALSTAILVGEAKKWLPELVERAKKLRVNAGDQPGADLGPL
ITPQAKERVCNLIDSGTKEGASILLDGRSIKVKGYENGNFVGPTIISNVKPNMTCYKEEI
FGPVLVVLETDTLDEAIKIVNDNPYGNGTAIFTTNGATARKYSHLVDVGQVGVNVPIPVP
LPMFSFTGSRASFRGDTNFYGKQGIQFYTQLKTITSQWKEEDASLSSPAVVMPTMGR
Download sequence
Identical sequences F1N7K8
ENSBTAP00000024584 XP_005893863.1.15283 ENSBTAP00000024584 9913.ENSBTAP00000024584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]