SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F1PXD6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1PXD6
Domain Number 1 Region: 594-723,788-854
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.57e-39
Family Hemopexin-like domain 0.00067
Further Details:      
 
Domain Number 2 Region: 68-107
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000017
Family Somatomedin B domain 0.0014
Further Details:      
 
Domain Number 3 Region: 26-66
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000131
Family Somatomedin B domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1PXD6
Sequence length 854
Comment (tr|F1PXD6|F1PXD6_CANLF) Uncharacterized protein {ECO:0000313|Ensembl:ENSCAFP00000020163} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=PRG4 OC=Canis.
Sequence
MQWKILPIYLLLLSVFLIQQVSSQDLPSCAGRCGEGYSRDAICNCDYNCQHYMECCPDFK
KACTVELSCKGRCFESFARGRECDCDSDCKKYGKCCPDYEDFCGRVHNPTSPPSSKTAPP
SPGASQTIKSTAKRSPKAPNKKKTKKVIESEEITEEHSVSENQESSSSSSSSSSTIRKIK
SSKNSAANKELKKKPKVKDNKKERTPKKKPPPEPPVVDEAGSGLDNGDIKLTPTPDIPTT
QRNKVTTSPKFTTGKPINPKPSLPPNTDTSKETSSTPNKETTVKSKETLANKETSSKAKE
KITSAKETRSAEKTPAKDFVPTTKAPVKSTPKAESTTKSPAPTTTKEPTPTTTKKPAPTT
PKKPAPTMTTTAKDKTTEKDIIPEITTAVPKITTQETATPTEETTTESKTSTTTQVTSTT
SSKNTPKATTLAPKVMTATQKTTTTEETMNKPEETTAVPKDTATSTKVSTPRPRKPTKAP
KKPASTKKPNTIPKRKKPKTTPTPPKMTTSTMPKLHPTSSVEAMLQTTTSPNQRPNSEIV
EVNPNEDTDAAGKKPHMFPRPPVLTPIFIPGTDILVRGSNQDIAINPMLSDETNLCNGKP
VDGLTTLRNGTMVAFRGHYFWMLSPSKPPSPPRKITEVWGIPSPIDTVFTRCNCEGKTFF
FKGSQYWRFTNDIKDAGYPKQIVKGFGGLNGRIVAALSIAKYKDRPESVYFFKRGGSVQQ
YTYKQEPIKKCTGRRPAINYPVYGETTQVRRRRFERAIGPSQTHTIRIHYSPIRVSYQDK
GFLHNEVKMSSQWRGFPNVVTSAIALPNIRKPDGYDYYAFSRNQYYNIDVPSRTARVVTT
RFGRTLSNIWYNCP
Download sequence
Identical sequences F1PXD6
ENSCAFP00000020163 ENSCAFP00000020163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]