SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F1R2S5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1R2S5
Domain Number 1 Region: 630-1034
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.18e-124
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000101
Further Details:      
 
Domain Number 2 Region: 29-294
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.33e-92
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00000112
Further Details:      
 
Domain Number 3 Region: 294-628
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 6.02e-81
Family Lipovitellin-phosvitin complex, superhelical domain 0.000000224
Further Details:      
 
Domain Number 4 Region: 1170-1337
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 8.24e-62
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F1R2S5
Sequence length 1363
Comment (tr|F1R2S5|F1R2S5_DANRE) Vitellogenin 5 {ECO:0000313|Ensembl:ENSDARP00000072687} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=vtg5 OC=Cyprinidae; Danio.
Sequence
XKPPAMRAVVLALTVALVASQQMNLVPEFAHDKTYVYKYEALLLGGLPQEGLARAGIKVS
SKVHLSAMTENTYLMKLMDPLLYEYAGTWPRDPFVPATKLTSALAAQLQIPIKFEYANGV
VGKVFAPAGVSPTVMNLYRGILNILQLNLKKTQNIYEMQEAGAQGVCRTHYVINEDPKTN
HIIVTKSKDLSHCQERIMKDVGLAYTERCAECTKRVKSLIETATYNYIMKPADNGALIAE
ATVEEVYQFSPFNEIHGAAMMEAKQTLAFVEIEKTPVVPIKADYMPRGSLQYEFASEILQ
TPLQLMKIKDAPAQTVEVLKHLVANNKDMVHDDAPFKFVQLVQLLRVATLEKIEAIWSQF
KDKPVYRRWLLDALPAVGTPVIIKFIKEKFLAGEFTTPEFIQTLVIALQMVTADIETIQM
TASLATHEKFASIPALREVVMLGYGSLIAKHCTAVPTCPAELLRPIHEIATEAISKNDIP
EITLALKVMGNAGHPSSLKPIMKLLPGLRTAANALPVKVQVDAILALRNIAKKEPKLVQP
VALQLVLDRALHPEVRMVACIVLFEAEPSVALISSLAGALRTEPNMHVSSFAYSHIKSLT
RITAPDMASVAGAANVAIKLMNCKLDRLNYRYSRAFHMDYYYTPLMIGAAGSAYMINDAA
TILPRAVVAKARAYLAGAAADVIEFGVRTGGINEALLKSPAAEESVDRITKIKRTLKALT
NWKALPTDRPLASAYFKVFGQEVAYVNFDKSIIEEAIPMVTGPKPRALLKEALKALQEGI
AFQYAKPLLAAEVRRIFPTAVGVPMEFSWYTAAVAAASVNVQATITPALPEKLESMTYEQ
LKKTDVQFQAEARPSVALQTFAVMGVNTAFIQAAVMARGKIRTIAPGKVAARADILKGNY
KVEALPVELPEHIASASFETLAVVRNIEDHSAERSVPFVPELSLQNSQASYAGDLSSEVS
PDASVRAPAPFDRTLCYAVPYIEIKGCVEVHSHNAAFIRNSTLFNIIGHHTARAAISRAE
GPAVERLEFEVQVGPRAAERLVKQINIIDDDTPEGQAFLLKLREILDTEAKNTPVSSESS
SSSRNSRSSSSSSSSTSTSSSSSSSSSSSSSSLSSSRMSKTATIIEPFRKFHKDRYLAHH
SATKDTSSGSAAASFEQMQKKNRFLGNDIPPVFAIIARAVRADQKLLGYQLAAYFDKPTA
RVQLIASSIAENDNMKICADGALLSKHKVTGKFSWGAECKQYAVFAKAEAGVLGEYPAAR
LEVEWERLPKIVTTYAKKVCKHILNAAYNTGFRFEKATNSEKEIELTAALPSQKSLNFIA
RIPEITMSKRDIHLPITVPINPDGTFSINEDFLSWIHKHIMEE
Download sequence
Identical sequences F1R2S5
ENSDARP00000072687 ENSDARP00000072687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]