SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F1SF29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F1SF29
Domain Number 1 Region: 216-275
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000607
Family VWC domain 0.0061
Further Details:      
 
Weak hits

Sequence:  F1SF29
Domain Number - Region: 153-213
Classification Level Classification E-value
Superfamily FnI-like domain 0.000408
Family Fibronectin type I module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F1SF29
Sequence length 325
Comment (tr|F1SF29|F1SF29_PIG) von Willebrand factor C domain containing 2 {ECO:0000313|Ensembl:ENSSSCP00000016565} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=VWC2 OC=Sus.
Sequence
MPSSTAMAVGALSSSLLVTCCLMVALCSPSIPLEKLAQAPEQPGQEKREHASRDGPGRVS
ELGRPARDEGGGGRDWKGKGGRGLTSREAWSRQKQAWPAQGGGAKAGDLQVRPRGDTPHE
EPPAASAQDAAGSDPGPTLEPPEEYAYPDYRGKGCVDESGFVYAIGEKFAPGPSACPCLC
TEEGPLCAQPECPRLHPRCIHVDTSQCCPQCKERKNYCEFRGKTYQTLEEFVVSPCERCR
CEASGEVLCAVSACPQTECVDPVYEPDQCCPICKNGPNCFAETAVIPAGREVKTDECTIC
HCTYEEGTWRIERQAMCTRHECRQM
Download sequence
Identical sequences F1SF29
XP_020919566.1.46622 ENSSSCP00000016565 ENSSSCP00000016565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]