SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F2J043 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F2J043
Domain Number 1 Region: 29-468
Classification Level Classification E-value
Superfamily ALDH-like 2.62e-116
Family ALDH-like 0.000000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F2J043
Sequence length 495
Comment (tr|F2J043|F2J043_POLGS) Aldehyde dehydrogenase {ECO:0000256|PIRNR:PIRNR036492} KW=Complete proteome; Reference proteome OX=991905 OS=Polymorphum gilvum (strain LMG 25793 / CGMCC 1.9160 / SL003B-26A1). GN=SL003B_3456 OC=Bacteria; Proteobacteria; Alphaproteobacteria; Polymorphum.
Sequence
MTAQGEASDQISDQISNQASDGASDGASGAGSLAALLARQRSAFLADGPPPLERRRAALR
ALKAALVARRRQFEAAARADFGHRPAQITAIMDLAPVVQAIKYQHRHLRRWMRPERRRVA
LTFQPGRAHVIRQPLGVVGILSPWNYPVSLALVPLATALAAGNRAMVKPSELTPATTELL
AAMLGEIFPQEQVAVVTGGADVGAAFSALPFDHLVFTGSTAVGRKVMRAAADTLVPLTLE
LGGKSPVIVEPGHPVERAAADIAFGKTANAGQTCIAPDYVLVHAADLDRFVAAYVAAVRH
YHPGGTADPAYTSMITARHAERQRALLDDAREKGARVIEIEAEPPPQQPLPNAVAPAVLL
DVTDEMTVMQEEIFGPLLPVLAYRSLDEAIAFVNARPRPLALYFFGVGRANRDKVLAGTT
SGNVTVNDVLLHYAQDDLPFGGVGQSGMGAYHGVEGFRALSHAKGVFEQARWNTGGLIRP
PFGRIASWIAAYLMR
Download sequence
Identical sequences F2J043
WP_013654187.1.65661 gi|328545073|ref|YP_004305182.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]