SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F2J2U8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F2J2U8
Domain Number 1 Region: 562-1025
Classification Level Classification E-value
Superfamily ALDH-like 1.96e-125
Family ALDH-like 0.000000523
Further Details:      
 
Domain Number 2 Region: 179-521
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 6.28e-115
Family Proline dehydrohenase domain of bifunctional PutA protein 0.00000000655
Further Details:      
 
Domain Number 3 Region: 14-178
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 4.18e-47
Family N-terminal domain of bifunctional PutA protein 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F2J2U8
Sequence length 1042
Comment (tr|F2J2U8|F2J2U8_POLGS) L-glutamate gamma-semialdehyde dehydrogenase {ECO:0000256|PIRNR:PIRNR000197} KW=Complete proteome; Reference proteome OX=991905 OS=Polymorphum gilvum (strain LMG 25793 / CGMCC 1.9160 / SL003B-26A1). GN=SL003B_3701 OC=Bacteria; Proteobacteria; Alphaproteobacteria; Polymorphum.
Sequence
MSASAPNPEIAAVPPFRAAYAPDDEGLVRQLLAETGLPADAEARIDARAAGYIQDMRSAR
SGLGGVEDFMREFGLTTREGLAMMVLAEALLRVPDAATADRLIEDKLAAARFDQAAGHKS
DTWLVSASSWALGVTARLLHPGDTPDTILAALVKRLGMPAVRTATRQAMRLLGHQFVLGE
TIGQALERASGQEAKGYRYSYDMLGEGARTAADAQRYFQAYAAAIEAIGTAAGNRPLPAR
PGISVKLSALHPRYEAVKADRVQAELLPRLLELVRMARRYDLNFTIDAEEADRLEISLDL
VAAVVADPVTAGWDGFGLAVQAYQKRGVEVVDWLVELARAGNRCLMVRLVKGAYWDTEIK
RAQERGLADYPVFSRKAATDLSYLACARRLLAARDILYPQFATHNALTVAQIQELAGPDG
GYEFQRLHGMGESLYRAVAERHGYPCRIYAPVGGHKDLLAYLVRRLLENGANSSFVSVVG
DAAVPVDRLLLRPADILDGGGRVRNAAIPLPSDLYGDSRRNSAGVELGHAEERARLVDGM
TAAVLSVAAATVLAPGLAPVGRPKPVHSPADGRTLVGEVVEADPEDAARAVGSAACGFEV
WSRCPVESRAAALERAADLIEANRDRLMALLALEAGKTLPDGIAEIREAVDFCRYYAAEA
RMRFGEGCLMPGPTGEENRYRLRGRGVFVCISPWNFPLAIFVGQVAAALVAGNAVVAKPA
EQTPLIAREAVTLLHRAGVPEDALLFMPGDGRVGAALTADPRIAGVAFTGSTETAWAINA
SLAAKRGPIVPLIAETGGINAMLVDATALPEQVCDDVVTSAFRSAGQRCSALRLLYLQDD
IADGLLEMIEGAAAELTLGDPRDQATDIGPVIDADARDGILAHIEAMAAADRLRFAGTVP
GGDLAGGFWVAPHIVTLDRPSDLTREVFGPVLHVVRYRAKELDAMLEAIAATGYGLTLGV
HSRIDATVKQVVDRLSVGNVYVNRNTIGAVVGTQPFGGSGLSGTGPKAGGPAYLQRFALE
QVVSINTAASGGNASLLAHSEE
Download sequence
Identical sequences F2J2U8
gi|328545317|ref|YP_004305426.1| WP_013654431.1.65661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]