SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F2J4F2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F2J4F2
Domain Number 1 Region: 28-243
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 6.47e-32
Family Methylenetetrahydrofolate reductase 0.0014
Further Details:      
 
Weak hits

Sequence:  F2J4F2
Domain Number - Region: 232-290
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.0687
Family GlnE-like domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F2J4F2
Sequence length 300
Comment (tr|F2J4F2|F2J4F2_POLGS) Methylenetetrahydrofolate reductase {ECO:0000256|RuleBase:RU003862} KW=Complete proteome; Reference proteome OX=991905 OS=Polymorphum gilvum (strain LMG 25793 / CGMCC 1.9160 / SL003B-26A1). GN=SL003B_2671 OC=Bacteria; Proteobacteria; Alphaproteobacteria; Polymorphum.
Sequence
MTEIRSRTIDEVQSACAPLRGPLWLAPWSLEATAPTAADIAALAPLVPPGTDVLLSALPR
IPHDEQIAAARLVRAAGLEPVLHLSARKFASEAELGHLLETACRDIGLRKVLVIAGDIDA
ARGPFASSLDLIESAPFRAAPLQSVGIGGYPEGHPFVADADLERSLRSRLDAIRDAGRAP
FLVSQFCFDAERILRWLDGLRRLEPALPVRIGLAGPASAATLMKVALRCWVDLPMRHART
ATRLLSSGTPDPIVAGLDAGLRPHHRSGPLQIHVYGFGGLVKAAAWAGEAARTARAGWTA
Download sequence
Identical sequences F2J4F2
gi|328544289|ref|YP_004304398.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]