SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F2J4K9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F2J4K9
Domain Number 1 Region: 3-472
Classification Level Classification E-value
Superfamily ALDH-like 8.51e-146
Family ALDH-like 0.0000000000332
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F2J4K9
Sequence length 475
Comment (tr|F2J4K9|F2J4K9_POLGS) Betaine-aldehyde dehydrogenase protein {ECO:0000313|EMBL:ADZ72261.1} KW=Complete proteome; Reference proteome OX=991905 OS=Polymorphum gilvum (strain LMG 25793 / CGMCC 1.9160 / SL003B-26A1). GN=SL003B_3841 OC=Bacteria; Proteobacteria; Alphaproteobacteria; Polymorphum.
Sequence
METHMLIGSAFEAGTETEETILNPKTGAAVLNLAEASAAQIDRAVDAADRAFATWSQTTP
AERSGYLLKIAERIEAEADGFAALEALNCGKPINAVKNDELPAIIDCYRFFAGAVRCIPG
SAAGEYMKGFTSMIRRDPIGIVASIAPWNYPLMMMAWKLAPAIAGGNTVVFKPSEQTPLT
ALKMARILADVLPEGVVNVVLGRGESVGNALINHPKVNMVSITGDVATGKKVLQAAAKSV
KRTHLELGGKAPVIVFDDADIDAVVNGLRAFGYYNAGQDCTAACRIYAGPKIYEKLVADL
SSAVSTIAFAREDDSENEIGPLISQRQRDRVASFVERALQQNHMEATAGGKAHDGNGFFF
QPTVIAGALQSDEIVRREVFGPVVSVTRFSDVDEAVAWANDSDYGLASSVWTKDVSRAMA
TAARLRYGCTWINTHFMLVNEMPHGGLKQSGYGKDMSLYALEDYTAVRHVMVAHG
Download sequence
Identical sequences F2J4K9
WP_013654571.1.65661 gi|328545457|ref|YP_004305566.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]