SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F2N8U7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F2N8U7
Domain Number 1 Region: 486-627
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 8.63e-24
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.0057
Further Details:      
 
Domain Number 2 Region: 284-387
Classification Level Classification E-value
Superfamily PTS-regulatory domain, PRD 3.92e-17
Family PTS-regulatory domain, PRD 0.0065
Further Details:      
 
Domain Number 3 Region: 176-268
Classification Level Classification E-value
Superfamily PTS-regulatory domain, PRD 4.58e-16
Family PTS-regulatory domain, PRD 0.0037
Further Details:      
 
Domain Number 4 Region: 393-470
Classification Level Classification E-value
Superfamily PTS system IIB component-like 0.00000732
Family PTS system, Lactose/Cellobiose specific IIB subunit 0.024
Further Details:      
 
Weak hits

Sequence:  F2N8U7
Domain Number - Region: 85-128
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00416
Family MarR-like transcriptional regulators 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F2N8U7
Sequence length 642
Comment (tr|F2N8U7|F2N8U7_CORGP) Transcriptional antiterminator, BglG {ECO:0000313|EMBL:AEB07547.1} KW=Complete proteome; Reference proteome OX=700015 OS=PW2). GN=Corgl_1447 OC=Coriobacteriaceae; Coriobacterium.
Sequence
MRDAEFVRFIRQTKPINPADAAARLHVSARTIRTYVHRANRAMEGFARITLSRESGYAIV
EQDSQRIEAWLSDALRSVETSPQTPQERIAYLLNDLLMRTDWITMDSLCDMLYISRSTLT
GDLKGVERELNRFDLSLLKRPHRGIRVEGEEMARRVCLANIAVESMSGGDLVHGHLLAVV
SRCVENVAHAQRFQIVTTGYQSLLVHIAIALLRIKEGCYVPMASEHLERLRPAREYAVAQ
MIAEGIEREIGIELPQEEIGYMAIHLAGKQTLLDSQGDAQGIVISDDVWGVVSRMLECIW
AAFRFDFRYDLELRMNLARHIVPLAVRLRYSMRLRNPMLPDIRIRYALAFAMAQEASHVL
GAAYGSEPSDDEIGYIALAFALALERQKTEVSKKSILMVCASGAGSARLLEFRCRREFAD
YIDTIATCDVLNLDAVDFSGIDYVFTTVPIERPLPVPVREVSYFLDGQDIVDLRDLLRGD
AVNEALHPFFKKSLFFPHMSTGTKEEALDYLIDRVAEREPVHEDFRNLVWRRERLVATSF
GNGVAMPHPLEPAAETTIVCIGLLDEPVAWDDSGCDVRAIFLVAFAPDVDDSLKSFLSVF
TDILSSARDIDLLVQHQSWKTFADIVASAFASARAPAPTERR
Download sequence
Identical sequences F2N8U7
WP_013709289.1.79872 gi|328956029|ref|YP_004373362.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]