SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F2NIB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F2NIB3
Domain Number 1 Region: 18-170
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 1.52e-28
Family MJ1460-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F2NIB3
Sequence length 175
Comment (tr|F2NIB3|F2NIB3_DESAR) 4-vinyl reductase 4VR {ECO:0000313|EMBL:AEB09882.1} KW=Complete proteome; Reference proteome OX=880072 OS=Desulfobacca acetoxidans (strain ATCC 700848 / DSM 11109 / ASRB2). GN=Desac_2053 OC=Syntrophaceae; Desulfobacca.
Sequence
MPGANHLFFHWESLGDLEIGRPNLGMMAPVLVYRLMLYTMRTVLTARFGLAETKRIFVAA
GRLAGEEFCRHLLNTQLEFDKFLTELQEKLVEHKIGILRVEELDIDTWDMTLTVAEDLDC
SGLPVTNETVCDYDEGFLGGILKAYTGNDFRVEEIDCWAKGDRVCRFKVNLIQAN
Download sequence
Identical sequences F2NIB3
gi|328953729|ref|YP_004371063.1| WP_013706991.1.50338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]