SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F2RWB7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F2RWB7
Domain Number 1 Region: 105-274
Classification Level Classification E-value
Superfamily Flavoproteins 0.00000000000000117
Family Flavodoxin-related 0.043
Further Details:      
 
Domain Number 2 Region: 420-605
Classification Level Classification E-value
Superfamily Radical SAM enzymes 0.000000000209
Family MoCo biosynthesis proteins 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F2RWB7
Sequence length 757
Comment (tr|F2RWB7|F2RWB7_TRIT1) Radical SAM domain-containing protein {ECO:0000313|EMBL:EGD95591.1} KW=Complete proteome OX=647933 OS=Trichophyton tonsurans (strain CBS 112818) (Scalp ringworm fungus). GN=TESG_03063 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence
MPLQIALSLWHAYRAYILVIIAVALFAGTKFSSQCKQAESQTKGAEQVTQNITVSDNPVQ
PGNTSLAKSTPLKSETKPGPKRLRGLRPLKGDANATAKVVSAIRPIFFFTSLTGTTEKSA
RVAFESVKSKLQAAPENAQCKVLDPELHDLSYIDFDDYFVTAPKPPTSEPGLSYLYCIIL
PSYDIDSIINNFLNHLDETHNDFRIDTSPLSGLTGYSVFGFGDKEGWPTVEEGFCSQALT
GKRRAYPLGFGDVKTDGDHSLQEWCDGLVSVLHDIAENGGGLGEGVPGSGDPIESDEEDA
EEDSQRPQNPSRPRRTKARNSQIADLEDIKFNPEDLLDDEPIDFTTYAPTKISSLSSKEM
VPSTSPTYAALTKQGYTIVGSHSGVKICRWTKSALRGRGSCYKNSFYGIKSHLCMESTPS
LSCSNKCIFCWRHGTNPVGTTWRWKVDPPELIFNGVKEGHYKKIKMLRGVPGVRAERFAE
AMRIRHCALSLVGEPIFYPHINELLSLLHNEHISSFLVCNAQHPDELAALQRVTQLYVSI
DASNRESLRKIDRPLHRDFWERLQRCLDILREKRNVHRTVYRLTLVKGFNIEDEVEGYAD
LVEKGLPCFIEIKGVTYCGTSSSSNAGLTMQNVPFYHEIVAFVVALNEELERRGLSYGLS
AEHAHSCCVLLASKRFLVNGKSHTRINYERFFELLEREKQTGESFAPEDYMRETEEWALW
GNGGFDPNDQRVHTKGKNKGKIGVPPPSGKVILAGTA
Download sequence
Identical sequences F2RWB7
TESG_03063T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]