SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F2S0D1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F2S0D1
Domain Number 1 Region: 248-523
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.22e-59
Family NADPH-cytochrome p450 reductase FAD-binding domain-like 0.0001
Further Details:      
 
Domain Number 2 Region: 522-682
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 3.14e-46
Family NADPH-cytochrome p450 reductase-like 0.00083
Further Details:      
 
Domain Number 3 Region: 63-232
Classification Level Classification E-value
Superfamily Flavoproteins 7.94e-46
Family Cytochrome p450 reductase N-terminal domain-like 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F2S0D1
Sequence length 683
Comment (tr|F2S0D1|F2S0D1_TRIT1) NADPH--cytochrome P450 reductase {ECO:0000256|HAMAP-Rule:MF_03212, ECO:0000256|PIRNR:PIRNR000208} KW=Complete proteome OX=647933 OS=Trichophyton tonsurans (strain CBS 112818) (Scalp ringworm fungus). GN=TESG_04452 OC=Eurotiomycetidae; Onygenales; Arthrodermataceae; Trichophyton.
Sequence
MAQVDTLDMLVLAVILVGTIAYFTKGKYWAVVKDPYASSYAATNSAKQGQTRNIVEKLEE
TGKNCVIFYGSQTGTAEDYASRLAKEGSQRFGLKTMVADLEDYDYACLDKFPEDKVAFFV
LATYGEGEPTDNAVEFFQFITGDDASFEDGGSPEDQPLSKMRYVAFGLGNNTYEHYNAMV
RIVDKALTKCGAKRIGDAGEGDDGAGTMEEDYLSWKEPMWKALAEEMGLEEREAVYEPTF
SVIEEEDLNIESENVYLGEPNASHLKGRGQGPYNAHNPFLSPIVESRELFSVKDRSQLNY
QTGDHIAIWPTNAGQEVDRFLKVFGLEEKRHTVIRVKPIDVTAKVPFPQPTTYDSVVRYY
IETCGPVSRQFISQLAAFAPDEETKKKMIRIGEDKDVFSDKVSAFYYNIAQALQSFTDKP
FTAVPFSLLIEGIPKIQPRYYSISSSSSVQKEKISITAVVESLRVPGASHVVKGVTTNYL
LALKQKQHGEPNPDPFGLTYAISGPRNKYDGFHVPVHVRHSNFKLPSDPSKPIIMVGPGT
GVAPFRGFIQERVHQAEKGETVGPTILFYGCRKSTEDFLYKEEFEEVSKKLGDSFKLITA
FSRETSQKVYVQHRLKEHAELVSDLLSKKANFYVCGDAANMAREVNVVLGQILAEQRGLK
PEKGEELVKHMRNTGSYQEDVWS
Download sequence
Identical sequences F2S0D1
TESG_04452T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]