SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F4B3R0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4B3R0
Domain Number 1 Region: 102-255
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 9.22e-27
Family Aminoacid dehydrogenase-like, C-terminal domain 0.0017
Further Details:      
 
Domain Number 2 Region: 1-98
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 1.32e-26
Family Shikimate dehydrogenase-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F4B3R0
Sequence length 262
Comment (tr|F4B3R0|F4B3R0_ACIHW) Shikimate dehydrogenase (NADP(+)) {ECO:0000256|HAMAP-Rule:MF_00222} KW=Complete proteome; Reference proteome OX=933801 OS=Acidianus hospitalis (strain W1). GN=Ahos_1214 OC=Acidianus.
Sequence
MFIDYSTKLFGIIGKKISYTLSPAIHNYSFEKLGINAVYLAFDIEEEKFDLIVKGLLEVG
EGFNVTIPYKEKIIPLLEGLSKEAEEIGAINTIFRKKGFNTDYLAVKSLVLEKGEKIEKS
LIFGAGGAAKAASFALSSLGSEIFIINRTRDKAQELVNRLTERGYYAKVVESCNFSYDAV
VNSTPNPSYIPGECIKGKLAIEFVYSPLNTEFLIKASKKGLRVINGLEILVRQALEAQKI
WFGKSLNDKEVVDFLYARKLVR
Download sequence
Identical sequences F4B3R0
gi|332796895|ref|YP_004458395.1| WP_013776013.1.74519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]