SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F4B4A1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4B4A1
Domain Number 1 Region: 3-265
Classification Level Classification E-value
Superfamily Folate-binding domain 1.73e-68
Family Aminomethyltransferase folate-binding domain 0.00000532
Further Details:      
 
Domain Number 2 Region: 258-345
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 5.89e-19
Family Aminomethyltransferase beta-barrel domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F4B4A1
Sequence length 346
Comment (tr|F4B4A1|F4B4A1_ACIHW) Aminomethyltransferase {ECO:0000313|EMBL:AEE94209.1} KW=Complete proteome; Reference proteome OX=933801 OS=Acidianus hospitalis (strain W1). GN=Ahos_1326 OC=Acidianus.
Sequence
MFKTPLSAVEEKIGANFGEFAGWEMPMDYSSYQDEHMAVRQSAAFFDLSHMGRIRIKGKK
EELDKIVTRSLSTENFRMIGPSAMLNEKGGFIDDIMIYKVSDTEFLMVTNAINREKDINW
IKRNSSLEVEDLTFDYVMLAIQGRRVWELLGYKTDLQPLQFVLNSNFLGEDVFLLSRSGW
TGEDGLEVWAKVEIAERIISKLMEKGIKPAGLITRDSLRQEMGFVLYGEDIDENTTPVEA
RYWVFDLDKNFIGKEKVEEQLKNGVKRIRVGFKLQKGIRAIPRHGYRIRILETEVGEVTS
STYSPYLGRVIGMGYINSSNAFFGFHANIEIRGKDYRAKISDFPLI
Download sequence
Identical sequences F4B4A1
WP_013776124.1.74519 gi|332797007|ref|YP_004458507.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]