SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F4B4Y7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4B4Y7
Domain Number 1 Region: 106-369
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 3.41e-75
Family D-glucarate dehydratase-like 0.0000522
Further Details:      
 
Domain Number 2 Region: 1-123
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.86e-26
Family Enolase N-terminal domain-like 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F4B4Y7
Sequence length 393
Comment (tr|F4B4Y7|F4B4Y7_ACIHW) Gluconate dehydrogenase {ECO:0000313|EMBL:AEE93152.1} KW=Complete proteome; Reference proteome OX=933801 OS=Acidianus hospitalis (strain W1). GN=Ahos_0261 OC=Acidianus.
Sequence
MKIQEIEPIVLTSKEKGGATWASTMILVKVTTSNGAVGYGEAVPTLRVISVYNAIKQVSK
AFIGKEVEEVEKNYHEWYKQDFYLARSFESATAVSAIDIASWDILGKELGSPIYKFLGGK
FRDKVLVYANGWYSDCVTPEDFANKAKDVVKRGYKGLKFDPFGQYYDWIDEKGLREAEER
VKAVREAVGDEVYIMIEHHGRFNANSAIKIAHVLEKYNPLFMEEPVHHEDIEGYKKYRSS
TKVTVALGERLISLKEAMFYIDNRLADVLQPDITNIGGVTIARKVVTLAEANDVEIAFHN
AFGSIQNAVSIQLSAVIPNLLILENFYDWFPQWKRDLVYNGTPVEDGYVKVPEKPGIGVD
VNEKLLEELKAEPIPLEVGEEPVWVVKNTWRGY
Download sequence
Identical sequences F4B4Y7
WP_013775069.1.74519 gi|332795950|ref|YP_004457450.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]