SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F4B5C7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4B5C7
Domain Number 1 Region: 238-583
Classification Level Classification E-value
Superfamily SIS domain 6.59e-78
Family double-SIS domain 0.0000247
Further Details:      
 
Domain Number 2 Region: 3-225
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 7.72e-45
Family Class II glutamine amidotransferases 0.0000885
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F4B5C7
Sequence length 585
Comment (tr|F4B5C7|F4B5C7_ACIHW) Glutamine amidotransferase class-II {ECO:0000313|EMBL:AEE93221.1} KW=Complete proteome; Reference proteome OX=933801 OS=Acidianus hospitalis (strain W1). GN=Ahos_0330 OC=Acidianus.
Sequence
MGGIFGFICNSPKDVNVAINGLKRLVYRGYDSAGIVYMNGKLTVKKIVGNITKVDLQISG
TSRIVLAHTRYASRGWPTLENAHPLFDCNKKIALVMDGVIDDYEEIRDKLIKQGHKFVST
TDTEVLPHLLENSQDYIRSSIEIIKNIKGIYSFAFIVDGINKIFAGSAGQPIVIGITQEC
KYVSSDLPSLNGFAENAIILPENSVAEISEDYVKIFDIQGNQITVQPKRVKYQEEIVDKG
GYPHFMLKEIYDIPSALISSFTSLMEKYLSLSAMIVYGAKNVYVIGNGTSLHAGLISSYY
FAEVGINVNVVSAAEFPYYALENIGTGSVIIAISQSGETADVIRSVKMAKQRGAVIVGIT
NSVGSRLALESNVYLPITAGPELAVPATKTFTSTLVVLRTLSLYTGLNSGKKSKSDIEKL
KEDLNNLSKALSSNLPQIEKQAEDAVAKINSESMYVTSSGINFPVAMEGALKFKEASLTH
AEGIQLGELLHGPIALTNKGYPIVVIKPAEEQAYDLYNKVVKSISDRGSPIILISNDGML
KSVETTRELSPIANVVPLQLMAYKLGVKKSLPIDTPPGLVKAVVS
Download sequence
Identical sequences F4B5C7
WP_013775137.1.74519 gi|332796019|ref|YP_004457519.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]