SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F4B716 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F4B716
Domain Number - Region: 62-129
Classification Level Classification E-value
Superfamily Apolipoprotein 0.00562
Family Apolipoprotein 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F4B716
Sequence length 231
Comment (tr|F4B716|F4B716_ACIHW) CopG/DNA-binding domain protein {ECO:0000313|EMBL:AEE93499.1} KW=Complete proteome; Reference proteome OX=933801 OS=Acidianus hospitalis (strain W1). GN=Ahos_0611 OC=Acidianus.
Sequence
MKTLVIKLTDEEYKQLEEEASKQGFAILSYYVKYKLLSSPSNDGINTSTTMTSSNITPQI
IDEITKKLERKIQDMVNPFTAEVENLKQKIADLSEKIDELESKKSEESEAKYEKQRQYSQ
PSGEKKKTVMDILKSQGAIYESEVKLKNPDLFFEKIEKQGGKVLYTDKERIAVDVDFFNN
FVKKLSDIHTSDDVEAQKYLTKQEHKLFQKLRQLGIIYFDNNTKAWKLSGI
Download sequence
Identical sequences F4B716
WP_013775415.1.74519 gi|332796297|ref|YP_004457797.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]