SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F4B8R6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4B8R6
Domain Number 1 Region: 1-218
Classification Level Classification E-value
Superfamily Triosephosphate isomerase (TIM) 7.85e-42
Family Triosephosphate isomerase (TIM) 0.00000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F4B8R6
Sequence length 232
Comment (tr|F4B8R6|F4B8R6_ACIHW) Triose-phosphate isomerase {ECO:0000256|HAMAP-Rule:MF_00147} KW=Complete proteome; Reference proteome OX=933801 OS=Acidianus hospitalis (strain W1). GN=Ahos_0900 OC=Acidianus.
Sequence
MKKPIILINFKAYENSFGKKGVDIAKRIEKISIEYSTEVILSVPATMIPILSQEVSLPIY
AQHVDSYPLGAHTGSLLPEMIKEAGAKGTLLNHSEKRIRADEIHDALLRLNKLGLESVVC
VDRYELVEPMAILRPTAILIEPPELIGSGISVSKAKPEVITNAVKEISKVPGVFLIAGAG
ISNGEDVYTAVKLGADGIGVASAVMKAKEPEKVVEDFIKSGIKAMDERNDRN
Download sequence
Identical sequences F4B8R6
2014260886 gi|332796584|ref|YP_004458084.1| WP_013775702.1.74519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]