SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F4B915 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4B915
Domain Number 1 Region: 1-160
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.59e-31
Family GHMP Kinase, N-terminal domain 0.0000315
Further Details:      
 
Domain Number 2 Region: 167-272
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 5.76e-24
Family Homoserine kinase 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F4B915
Sequence length 309
Comment (tr|F4B915|F4B915_ACIHW) Homoserine kinase {ECO:0000256|HAMAP-Rule:MF_00384} KW=Complete proteome; Reference proteome OX=933801 OS=Acidianus hospitalis (strain W1). GN=Ahos_2167 OC=Acidianus.
Sequence
MSAKAEAYSSSANLGPGFDILSMAHTAFKDIVIARTIEEKGKIIIKSNNPKIPLDPEKNS
AGLATKILLQEKGIDEGIEIEINKGIPFGLGLGSSGASSVAAIAAVNELFELKLTQEEMV
KYSMFGEQASSGSPHPDNVAASVYGGIIAVTSVSPVKVEKIPVNLDFKILLISPQGEREG
KTKKAREMLPSKVDLSLYVKNSRYLSSLILGFIKGDKELIKQGLNDEIVEVAREPLYPHY
KKIKEIALKNDAIGSCVSGAGPTVLVLYDDNTNLDKIKVESLEVCKAFGLACNFILAQIA
GGVKSERLN
Download sequence
Identical sequences F4B915
gi|332797836|ref|YP_004459336.1| WP_013776953.1.74519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]