SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F4D1X2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4D1X2
Domain Number 1 Region: 16-92
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 5.31e-18
Family GntR-like transcriptional regulators 0.024
Further Details:      
 
Domain Number 2 Region: 106-230
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 7.06e-18
Family GntR ligand-binding domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F4D1X2
Sequence length 239
Comment (tr|F4D1X2|F4D1X2_PSEUX) GntR domain protein {ECO:0000313|EMBL:AEA28032.1} KW=Complete proteome; Reference proteome OX=675635 OS=13855 / CB1190). GN=Psed_5909 OC=Pseudonocardia.
Sequence
MSVQDSEFVFEPIGAGRGFEKIVTSLRGAIVRGELVAGQRLPSEPELAGQLGVSRPMLRE
ALKALEVSGYLEVRRGYGGGRFVAMPEPEEFHAITAAPLSTMDVEPRHVMDVRLAVEPMA
ARLSAQDGDTADLERALRMLGMAGTRPARAVAAVASFHVALVEASQNPVFVAVFESLRGP
VAMSLGQRVRERDWPGRARDGLAHVVRLIEDGEGGAAERAMRKYLLDFEDDRDQREEDR
Download sequence
Identical sequences F4D1X2
WP_013677930.1.25045 gi|331699646|ref|YP_004335885.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]