SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F4FY29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4FY29
Domain Number 1 Region: 91-212
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 0.000000000405
Family Band 7/SPFH domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F4FY29
Sequence length 291
Comment (tr|F4FY29|F4FY29_METCR) Band 7 protein {ECO:0000313|EMBL:AEB95402.1} KW=Complete proteome OX=1006006 OS=Metallosphaera cuprina (strain Ar-4). GN=Mcup_1298 OC=Metallosphaera.
Sequence
MSLQFRGQVISTEREDGTSLMAPDVLIFRYPKEQITSKSLFIVQPTENCVVVIQGQVQAV
LPPGTHNIQSPQNPLSSFMSRFRYNQLPFDTVALFVSTTRHEVRIQGKSQTDDLVPLDYE
VAVYYRITDPSKLVINVQFAGAFFKDGELASYLSPIIDQEVSSILNQVKLVDVYKKFGDI
SVAVTGALKQFLAELGVELISVRVTRLIPEDPELRRIIQLRDLGLEVEKAVRMGLARVLT
EQGNPASVNMAIGTPYYPNLTTLVNLPQRLLQFSMGGKEVEKDEQDQPKGA
Download sequence
Identical sequences F4FY29
gi|330835158|ref|YP_004409886.1| WP_013737900.1.2613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]