SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F4FZD5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4FZD5
Domain Number 1 Region: 3-92
Classification Level Classification E-value
Superfamily all-alpha NTP pyrophosphatases 7.29e-26
Family HisE-like (PRA-PH) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F4FZD5
Sequence length 93
Comment (tr|F4FZD5|F4FZD5_METCR) Phosphoribosyl-ATP pyrophosphatase {ECO:0000256|HAMAP-Rule:MF_01020} KW=Complete proteome OX=1006006 OS=Metallosphaera cuprina (strain Ar-4). GN=Mcup_0336 OC=Metallosphaera.
Sequence
MSNVLDELYSIILSRLKDKPEGSYTASLLEKGKPYIARKVGEEAIEVIVASTSEGKERLV
SETCDLLYHLLVLLAVEGIPLEEVYGELRRRMK
Download sequence
Identical sequences F4FZD5
WP_013736942.1.2613 gi|330834200|ref|YP_004408928.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]