SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F4GCL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4GCL7
Domain Number 1 Region: 19-330
Classification Level Classification E-value
Superfamily SIS domain 1.31e-64
Family mono-SIS domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F4GCL7
Sequence length 333
Comment (tr|F4GCL7|F4GCL7_ALIDK) KpsF/GutQ family protein {ECO:0000313|EMBL:AEB87025.1} KW=Complete proteome; Reference proteome OX=596154 OS=Alicycliphilus denitrificans (strain DSM 14773 / CIP 107495 / K601). GN=Alide2_4725 OC=Comamonadaceae; Alicycliphilus.
Sequence
MPTATAAFPSFNAEQALRLGRETFDIEAAALQGTGGRLGAVFVQAVQRVLATSGRVIVMG
MGKSGHVGRKIAATLASTGTPSFFVHPAEASHGDLGMVAGGDLVLAISNSGESSEITVLL
PMLKRQGVPLIAMTGGLQSTLARHADLVLDCSVEREACPLNLAPTTSTTVQLAMGDALAV
ALLDARGFRPEDFARSHPGGALGRRLLTHVRDVMRTGGQVPRVPPQADFSTLMREMSAKG
VGASAVVDEAGCPVGIFTDGDLRRRIEAGADLRGMRAQDVMHASPRTIAADALAADAAQA
MERHSITSVLVTDAQGVLVGVVHIGDLMRAKVI
Download sequence
Identical sequences A0A0E9L7B1 E8TZG8 F4GCL7
WP_013521137.1.1403 WP_013521137.1.61486 WP_013521137.1.73355 gi|330827238|ref|YP_004390541.1| gi|319765046|ref|YP_004128983.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]