SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F4GYT2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4GYT2
Domain Number 1 Region: 148-473
Classification Level Classification E-value
Superfamily Phase 1 flagellin 3.79e-16
Family Phase 1 flagellin 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F4GYT2
Sequence length 480
Comment (tr|F4GYT2|F4GYT2_CELFA) Flagellar hook-associated protein FlgK {ECO:0000313|EMBL:AEE44801.1} KW=Complete proteome; Reference proteome OX=590998 OS=/ NCIMB 8980 / NCTC 7547). GN=Celf_0661 OC=Cellulomonas.
Sequence
MSTFSGLGTALSSLIAQRQALDVAGQNVANANTVGYTRQRASMSALPAAQVPSMFSVNHG
AGEGVRVTGIERLGDVFLDMRLRTQTGGASYLAARADAYATLEKSLGEPGETGLASQLAT
MWGAWADLSNTPDKDSARAVVMQESTAVADRIATLYTAARTQWTQALSTTTALVDKVNTT
AAGVADLNARILEITNSGGTANELADQRDLLVMDLASLVGASAVTRENGQVDVLVGGNAL
VSGKRAHALEVQGARSFAQATGDTATPGQPVTVVWAERPTQSAGLDGGRVAGLLSVLAPA
GPGGTGGPLVEAAARYDALAQTIATKVNAFHSTAVTTTGAAGGDFWAVDGPEPPALALRI
AVADRSAIAVAAAGAGALDGSVGDQIAALKTDETGPDAHWSATVVDLGVRAASASARSKV
AESARVTAQQQQLAATSVDTDEETVNMLAFQRAYEGAARVLTAVDEMLDTLINRTGLVGR
Download sequence
Identical sequences F4GYT2
gi|332669180|ref|YP_004452188.1| WP_013769830.1.46799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]