SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F4HIQ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4HIQ7
Domain Number 1 Region: 532-916
Classification Level Classification E-value
Superfamily Hypothetical protein PH1602 2.75e-147
Family Hypothetical protein PH1602 0.000000000000784
Further Details:      
 
Domain Number 2 Region: 76-174,209-235,465-532
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 2.16e-30
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.03
Further Details:      
 
Domain Number 3 Region: 1-77
Classification Level Classification E-value
Superfamily Hypothetical protein PH1602 1.24e-25
Family Hypothetical protein PH1602 0.00000907
Further Details:      
 
Domain Number 4 Region: 319-428
Classification Level Classification E-value
Superfamily Homing endonucleases 3.83e-18
Family Intein endonuclease 0.04
Further Details:      
 
Weak hits

Sequence:  F4HIQ7
Domain Number - Region: 227-315
Classification Level Classification E-value
Superfamily Homing endonucleases 0.0808
Family Group I mobile intron endonuclease 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F4HIQ7
Sequence length 916
Comment (tr|F4HIQ7|F4HIQ7_PYRSN) tRNA-splicing ligase RtcB {ECO:0000256|RuleBase:RU371113} KW=Complete proteome OX=342949 OS=Pyrococcus sp. (strain NA2). GN=PNA2_0188 OC=Pyrococcus.
Sequence
MRVPGRVYADDVLLEKMKSDRTLEQAANVAMLPGIYKYSIVMPDGHQGYGFPIGGVAAFD
VKEGVISPGGIGYDINCLAPGSRVLTEHGYWIKIEELPEKFKLQGVKVYNLDEGHNDASK
IAFVAEREVEENEMAVRIVTESGKVIEGSEDHPVLTPQGYVYLGNIKEGDLVIVYPFEGV
EYEERQGVILDEKAFEGEDPQVLKFLSEKNLIPLRWDDPKIGTIARILGFAFGNGHLDEM
AGRLTLAFYGKEETLKELKKDLEKLGISASLYVHEQDYSIGYEGKSVSAELRVTSRSFAL
LLEKLGMPRGKKTEKAYCVPKWIMEAPLWVKRNFLAGLFAADGSIVEFKGNTPLPINLTH
SKDEELSESLIEFFGDVAKLLAEFGIKTTIYEVKSGKGVTYRLSIVGEESIKTFVERINY
EYDLEKKAKGLIAAAYLKLKERVRDEHRKAIEKAIEVYERTGSIHDGYREPRVPKDFPTF
EEFARERGYEGGFVAERVVKVERVRPSYTKFYDIGVYHEAHNFIANGIVVHNCGVRLIRT
NLTEKEVRPKIKQLVDTLFKNVPSGVGSEGRIKLRWTQIDDVLVDGAKWAVDNGYGWERD
LERLEEGGRMEGADPDAVSQRAKQRGAPQLGSLGSGNHFLEVQVVDKVYDEEIAKAYGLF
EGQVVVMVHTGSRGLGHQVASDYLRIMERAIRKYRIPWPDRELVSVPFESEEGQKYFSAM
KAAANFAWANRQMITHWVRESFQEVFRQDPEGDLGMDIVYDVAHNIGKVEEHEVNGKKVK
VIVHRKGATRAFPPGHEAVPKIYRDVGQPVLIPGSMGTASYVLAGTEGAMRETFGSTCHG
AGRVLSRKAATRQYRGDRIRQELLNRGIYVRAASMRVVAEEAPGAYKNVDNVVKVVSEAG
IAKLVARMRPIGVAKG
Download sequence
Identical sequences F4HIQ7
gi|332157831|ref|YP_004423110.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]