SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F4IF36 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4IF36
Domain Number 1 Region: 682-745
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000226
Family PHD domain 0.011
Further Details:      
 
Domain Number 2 Region: 234-456
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000385
Family RNA helicase 0.094
Further Details:      
 
Domain Number 3 Region: 837-936
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000416
Family Tandem AAA-ATPase domain 0.027
Further Details:      
 
Weak hits

Sequence:  F4IF36
Domain Number - Region: 29-61,106-144
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0837
Family Di-heme elbow motif 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F4IF36
Sequence length 1295
Comment (sp|F4IF36|FGT1_ARATH) Protein EMBRYO DEFECTIVE 1135 {ECO:0000303|PubMed:15266054} KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=YUP8H12R.3 OC=Arabidopsis.
Sequence
MTQSPVQPPPPLPAQPHSAAGGVIRGDVQVRCAGCRVILRVKTGVVEFSCPTCQLPQMLP
PELLSRARPQFPQSPQQPPQPIQTLPPPIQQQLKPLNLPRPPVPAHGIDPTKMQLPCANC
QAILNVPHGLTRFSCPQCHVELAVDVSKLNRSLTASQSHSNPPTPAAPTVPPPPPPEEVN
EEAIEVEREEDEGGTAGETFMDYRPPKLSIGPPHPDPIVETSSLSAVQPPEPTYDLKIKE
ELERSKALSCLQIETLVYACQRHLQHLADGTRAGFFVGDGAGVGKGRTIAGLIWENWKHG
RRKALWISIGSDLKYDARRDLDDVGATCVGVNPLNKLPYSKLDSKNVGIKEGVVFLTYNS
LIASSEKGRSRLQQLVQWCGPEFDGLLIFDECHKAKNLVPEAGSQPTRIGQAVVDIQDKI
PQARVIYCSATGASEPRNMGYMVRLGLWGAGTSFSDFNKFLGALDKGGTGALELVAMDMK
ARGMYVCRTLSYKGAEFEIVEARLEAGMEAMYNKSAEFWAELRIELLSASAFLPNEKPNS
SQLWRLYWSSHQRFFRHLCMSAKVPVTVRLAKKALSTNKCVVIGLQSTGEARTEEAVNKY
GLELDDFVSGPRELLLKFVEENYPLPEQPEPLSEDDSVKELQRKRHSASPGVSIRGRVRK
MAKWKPDSDNESDLESEADSADDSNDSDDEFQICQICSGEDERKKLLHCSECDKLFHPDC
VVPPVIDLPSEAWICFSCKEKTEEYIQARRLYIAELQKRYEAALERKSKIIEIIRSLNLP
NNPLDDIVDQLGGPEKVAEMTGRRGMLVRASNGKGVTYQARNTKDITMEMVNMHEKQLFM
DGKKLVAIISEAGSAGVSLQADRRAVNQKRRVHLTLELPWSADRAIQQFGRTHRSNQTSA
PEYRLLFTNLGGERRFASIVAKRLETLGALTQGDRRAGPSGPSLSAYNYDSNFGKKSLMV
MYRGIMEQEKLPVLPPGCSIDEPETVKEFLTKARAALVAVGIVRDSVLANGKDVGRFSGR
IIDSDMHDVGRFLNRLLGLPPDIQNRLFELFTSILDVLVHNARIEGSFDSGIVDMKANSV
ELLSTPKTVHVDQMSGASTMLFTFTLDRGVTWESASSMLEGKRRDGLGSANDGFFESKRE
WLGRRHFILAFESAASGLFKIVRPAVGESIREMSLSELKTKYRKLSSLEKARTGWEDEYE
VSSKQCMHGPKCKLGEYCTVGRRIQEVNVVGGLILPIWGTIEKALSKQARHSHKRIRVIR
IETTTDNQRIVGLSIPNAAVETVLQDLAWVQEIDD
Download sequence
Identical sequences F4IF36
AT1G79350.1 AT1G79350.1 NP_178053.4.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]