SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F4IYH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4IYH6
Domain Number 1 Region: 203-266
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000886
Family PHD domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F4IYH6
Sequence length 994
Comment (tr|F4IYH6|F4IYH6_ARATH) RING/FYVE/PHD zinc finger superfamily protein {ECO:0000313|EMBL:AEE73875.1} KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=F13E7.16 OC=Arabidopsis.
Sequence
MADRRVGNRPMGRRGRLEIQSGTCNVCSAPCSSCMHHNAEFSGSKSDESSDENSHGVLAS
QCSFNGDNLLRSSGVNAPGSSHNTSSEASHLVNSNHDTSSENAESKEIIRSSDISHGPLL
DRPHKDQDSMKVDSCNDHQARSTLGQGKVKEKSGAKNNEEKKNTLTGSSKHSGPRVGKSG
ENVLLNKADESNTSAMSDSESENDPEMLELDVKVCDTCGDAGREDLLAICSRCSDGAEHT
YCMRVMLKKVPKGYWLCEECKFAEKAEKHKLETKRKRESEVNVNTQISSKRHIDKFEAVP
DSKRLAVGAQIGSPKRSVLPRMSTLSRETSFKGLEKPTRKLAHYSSFNSHSSDDTESTRS
TDSQLQSPKGSFLKSNSFNSLSSRSKVRPVDDDMLPRQKTGNENSSLEVKEGFSKNVGKS
MSSRCIDVGSSNCNDSKVKGSKQLKDWSTEANPSASISRGNSSIPYAKSPRDLKDLQSDG
KQGSLSKQARHLSRNRLEDIVASVGDSSKNEKCSSSEQISSEAKCKDELAQVDGVPRSRE
FREAGEKTKDAVGNHQKRNIGEDNNKGNRLRAAVDAALRKKPSFSKNRGLEQSDLPPVSN
VDSGCNKALKCLSSKVPVIRDWPVGFQGLPGGHPNLRTDKQTNTVNEKQFTLAGTDATTA
SQSVEPEVNDPSVQSVMRDLPVAAPNVLSTTSAIPKPEYIWQGDLEVQKSRNLSAMHSGI
QAYLSTLASPKVVEVVKQFPEKVTLNEVPRLSSWPAQFQDTGAKEQHVALFFFAKDIESY
EKNYKPLVDNMIQKDLALKGNLEGVELLIFASNQLPQDCQRWNMLFFLWGVFRGKKESCS
NPPKNTPLPASCVSPNRDTFRHENPSNKKSLTDRTLSRMQSCMKEEDAKEGKACSGTEKE
NAFSVSYGEGEVDVETEEGEIGVSPQLKYEKTAGPGTVKSADMNQRVNVDDLNKEGLCEG
PANKKLKTVTGVETGCSIVRRDTSVHKFASRKFV
Download sequence
Identical sequences F4IYH6
AT3G02890.1 AT3G02890.1 NP_186939.2.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]