SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F4J2B8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4J2B8
Domain Number 1 Region: 57-191
Classification Level Classification E-value
Superfamily HSP20-like chaperones 1.12e-33
Family Co-chaperone p23-like 0.000000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F4J2B8
Sequence length 204
Comment (tr|F4J2B8|F4J2B8_ARATH) HSP20-like chaperones superfamily protein {ECO:0000313|EMBL:AEE73987.1} KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=At3g03773 OC=Arabidopsis.
Sequence
MCDRYRFKGFNICLLKSIAVFLHPPFIIPAPFIQNLHLAENMSSKLRIFVIDIRMIRNPE
VLWAQRSDKVYLTVALPDAKDISVKCEPQGLFSFSALGAQGERFEFSLELYGKIMTEYRK
NVGLRNIIFSIQKEERSWWTRLLKSEEKPAPYIKVDWNKWCDEDEEVNSETASDDESAFV
NQDSESSDDDGLLYLPDLEKARNK
Download sequence
Identical sequences F4J2B8
3702.AT3G03773.2-P NP_001154589.1.80155 AT3G03773.2 AT3G03773.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]