SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F4JHJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4JHJ0
Domain Number 1 Region: 1-156
Classification Level Classification E-value
Superfamily HSP20-like chaperones 2.97e-30
Family Co-chaperone p23-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F4JHJ0
Sequence length 240
Comment (tr|F4JHJ0|F4JHJ0_ARATH) HSP20-like chaperones superfamily protein {ECO:0000313|EMBL:AEE82174.1} KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=T14P8.5 OC=Arabidopsis.
Sequence
MSRHPEVKWAETTEKIFLTVVLADTKDTKVNLDPEGVFDFSAKVGPENHVYELKLELADK
VNVEESKINIGERSIFCIIEKAEPERWNKLLRVKKPPHYVKVDWDKWVDEDDEGSAGAAD
MDMAGMEGMGGMGGMGGMGGMGGMGGMGGMGGMEGMDFSKLMGGMGGMGGMGGLEGLGGM
GGMGGMGGMGGMGGMEEFEDSDDEETAKSGDKKDDAVKEEGLATEKAPAAEETTSVKEDK
Download sequence
Identical sequences F4JHJ0
AT4G02450.2 NP_001154201.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]