SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F4K148 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4K148
Domain Number 1 Region: 303-690
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 7.24e-98
Family Regulator of chromosome condensation RCC1 0.0006
Further Details:      
 
Domain Number 2 Region: 59-163
Classification Level Classification E-value
Superfamily PH domain-like 3.7e-27
Family Pleckstrin-homology domain (PH domain) 0.004
Further Details:      
 
Domain Number 3 Region: 691-761
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.54e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0023
Further Details:      
 
Weak hits

Sequence:  F4K148
Domain Number - Region: 898-975
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0235
Family Myosin rod fragments 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F4K148
Sequence length 1139
Comment (tr|F4K148|F4K148_ARATH) Regulator of chromosome condensation (RCC1) family with FYVE zinc finger domain-containing protein {ECO:0000313|EMBL:AED92704.1} KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=F7K24.170 OC=Arabidopsis.
Sequence
MWSGFRDCTRNGRMTPSDLSRAGPVTRDIEQLKIELYSTFGVSKLDSSYILENKNALHAI
TALKKGAYLLKYGRRGKPKFCPFRLSNDESVLIWFSGKEEKHLKLSHVSRIISGQRTPIF
QRYPRPEKEYQSFSLIYDERSLDLICKDKDEAEVWFSGLKALISRCHQRKWRTESRSDGT
PSEANSPRTYTRRSSPLHSPFSSNESFQKEGSNHLRLHSPYESPPKNGVDKAFSDMSLYA
VPPKGFFPPGSATMSVHSLSSGGSDTLHGHMKGMGMDAFRVSLSSAISSSSHGSGHDDGD
TLGDVFMWGEGIGEGVLGGGNHRVGSSLEIKMDSLLPKALESTIVLDVQNIACGGQHAVL
VTKQGESFSWGEESEGRLGHGVDSNVQHPKLIDALNTTNIELVACGEYHSCAVTLSGDLY
TWGKGDFGILGHGNEVSHWVPKRVNFLMEGIHVSSIACGPYHTAVVTSAGQLFTFGDGTF
GVLGHGDRKSVFIPREVDSLKGLRTVRAACGVWHTAAVVEVMVGSSSSSNCSSGKLFTWG
DGDKSRLGHGDKEPKLVPTCVAALVEPNFCQVACGHSLTVALTTSGHVYTMGSPVYGQLG
NPHADGKVPTRVDGKLHKSFVEEIACGAYHVAVLTSRTEVYTWGKGSNGRLGHGDADDRN
SPTLVESLKDKQVKSIACGSNFTAAVCLHKWASGMDQSMCSGCRQPFNFKRKRHNCYNCG
LVFCHSCSNKKSLKACMAPNPNKPYRVCDRCFNKLKKAMETDPSSHSSLSRRESVNQGSD
AIDRDEKLDTRSDGQLARFSLLEPMRQVDSRSKKNKKYEFNSSRVSPIPSGGSHRGSLNI
TKSFNPTFGSSKKFFSASVPGSRIASRATSPISRRPSPPRSTTPTPTLSGLTTPKIVVDD
TKRSNDNLSQEVVMLRSQVENLTRKAQLQEVELERTTKQLKEALAIASEESARCKAAKEV
IKSLTAQLKDMAERLPVGSARTVKSPSLNSFGSSPDYAAPSSNTLNRPNSRETDSDSLTT
VPMFSNGTSTPVFDSGSYRQQANHAAEAINRISTRSKESEPRNENEWVEQDEPGVYITLT
ALAGGARDLKRVRFSRKRFSEKQAEEWWAENRGRVYEQYNVRIVVDKSSVGVGSEDLGH
Download sequence
Identical sequences F4K148
NP_001190338.1.80155 AT5G19420.2 AT5G19420.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]