SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F4K4G6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4K4G6
Domain Number 1 Region: 643-694
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000062
Family PHD domain 0.0039
Further Details:      
 
Weak hits

Sequence:  F4K4G6
Domain Number - Region: 845-905
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000225
Family N-acetyl transferase, NAT 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F4K4G6
Sequence length 1193
Comment (tr|F4K4G6|F4K4G6_ARATH) RING/FYVE/PHD zinc finger superfamily protein {ECO:0000313|EMBL:AED94096.1} KW=Complete proteome; Reference proteome OX=3702 OS=Arabidopsis thaliana (Mouse-ear cress). GN=F24C7.4 OC=Arabidopsis.
Sequence
MLETNEQKGFDLNVCASIEDFSESDIKAEGETDSLVDGNVENVIEIKDKKKVIEREILIT
RRVLRSGSVARDLVNSDKHCKAVKRKGNVVSGGSSVDEVKEEVKQECVKSLVPEEIRGDD
FRSEVKVESKDDRSDDGKEEKVQRKRGRPRKFGMSSQSDDNGLISNCKLRTSLGKKKELV
GDDNVEKLVGGSCFNKEKAEVKLEHGEYAEDKEILGLDFRSQVKVEIKDDECGIVELHDE
ELQVKRKRGRPRKVQISSQSDESRPNTNCKLARTPELSSQSSVDRISLSRLRGRPPKTKE
TSVSLYIEKGPESNGRRMVRKRGRPPTPQKKRKSGMTDESDWKAKKRLKLCESPLESRHN
NPLIDDERMIGEQRSKQTEAGGHSRSKSKKMLSDRILQLLLTAGWTVEYRPRNGRAYQDA
VYLNPEGKTHWSVTKAYQVYKKQLESNPNDQKNSTTGSGFGLLPEEDLHLLERTIQKKRS
DTGKQRSKLKDRDTNDILVSTKGTGKIKREEKHSRKRCTPSARSSLKDVDSKEDGYILFE
GKRTMLGWMIDSTIVPLNGKVQCMDCKKTDILLEGIITKEGIRCNCCDEVFSVLDFEVHA
GGNRNQPFKSLYLEGGNSLLQCLHESMNKQSESQLKGYHFVDFGSGDPNDDTCGICGDGG
DLICCDGCPSTFHQSCLDIKKFPSGAWYCYNCSCKFCEKDEAAKHETSTLPSLSSCRLCE
EKCSKHYPHTLADHQACINQDGTVPGERSTDSFCGKYCQELFEELQLFIGVKHPLPEGFS
WSFLRRFELPSEVADCDISEKIAYNAKMAVAFSVMDECFSPLVDHRSGVNLLQNIVYNFG
SNFHRLDFSSFLTAVLERGDEIIAVASIRIHGNQLAEMPFIGTRYMYRRQGMCRRLMDGI
ESFVAYFSQMFLAISEVLLDVWQFCCYPACFGDGPFCFFSGFGFAPVNDSEKKTIKNLNL
LVFPGVDMLGKSLVKEKITDSVVSSPNGLVLLAPEMTLPVDVEENKPEESKDSAHERNCA
TAGVESPSNPVDSCLKLTYVEEGDNDRESNLKLLDGSVEEKEDTKKLTDIDINSLPDEVD
DSHADQSDTKEQEIDDKEDKTPLSDDGCEGKAEGTKESNQQPDSNKVDNSQPLGNGGTGE
ELGNRTLALKREVTPTLRASPRLIQRSWRTSRVNQKFTGTTNAVLLDSPHRCV
Download sequence
Identical sequences F4K4G6
AT5G36670.1 3702.AT5G36670.1-P AT5G36670.1 NP_568537.1.80155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]