SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F4KJD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4KJD3
Domain Number 1 Region: 272-569
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 3.14e-78
Family DNA repair protein MutS, domain III 0.00000253
Further Details:      
 
Domain Number 2 Region: 571-806
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.41e-56
Family ABC transporter ATPase domain-like 0.00000121
Further Details:      
 
Domain Number 3 Region: 6-114
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 5.62e-39
Family DNA repair protein MutS, domain I 0.0000362
Further Details:      
 
Domain Number 4 Region: 115-271
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 1.7e-36
Family DNA repair protein MutS, domain II 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F4KJD3
Sequence length 874
Comment (tr|F4KJD3|F4KJD3_PORAD) DNA mismatch repair protein MutS {ECO:0000256|HAMAP-Rule:MF_00096, ECO:0000256|SAAS:SAAS00825254} KW=Complete proteome; Reference proteome OX=879243 OS=asaccharolyticus). GN=Poras_0626 OC=Porphyromonadaceae; Porphyromonas.
Sequence
MAKKEIAETPMMRQYLQFKKKHPDAILLFRVGDFYETFSDDAIEASKILGITLTKRANGA
AQHVELAGFPHHALDTYLPKLVRAGKRVAICDQLEDPKLTNKLVKRGITEIVTPGVVTTD
NVLQSKQNNFLAAVYPQAKGENRYGLALLDLSTGEFYASECTDQVLAKLVSGYNPKEILI
ERKHRDHLQRLLQPEGHLSDYDDWIFSESNNRERLLQHFGTLSLKGFGIDTLPLAITAAG
AVLHYLDMTKHTEIGHITRIVRIDEQRHVRIDGFTAHSLELTTPMNAGGTTLRQILDQTV
TPMGARLLDQWIAFPLKELQAIQQRQSIVANLVDNPQLRTQLTDQMKEIGDLQRLVGRVA
MGRITPREVVRLGLSITLIAPIRQLALDEGEETLTALCSLLDPCAQLCQQITFQLNPEAP
QQIGKGETIAEGFCEELDQLRRLLKSGKQYLDDLLARETEHTGISSLKIGFNNVFGYYLE
VRNTYKEQVPEEWIRKQTLVSAERYITQELKEYEEKILGAEDRILALEQELFAKLIGTLQ
QFANQLLQDAQILAQLDVLASLAAVAKAYDYCRPTLNEGYDLEIVDGRHPVIERTLPAGQ
PYIPNDVRLSPIDCQIMIITGPNMSGKSALLRQTALIVIMAQMGSFVPATSATIGIVDSV
YTRVGASDNIAVGESTFMVEMQEAASILNNLTPRSLILFDELGRGTSTFDGVSIAWAIVE
YLHSTTQGRAKTLFATHYHELNELADHLERVQCYNVSAREIDGEMLFLRKLVPGGSAHSF
GIQVAKLAGMPTWIVARAGEVLQHLEAYRTESDQAPDSATPSTSQSGGMQMSIFQLDDPV
LTAVRTKINELDINNLTPLDALKQLDALKQMLNN
Download sequence
Identical sequences F4KJD3
gi|332299823|ref|YP_004441744.1| WP_013760146.1.45769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]