SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F4LTK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4LTK9
Domain Number 1 Region: 6-165
Classification Level Classification E-value
Superfamily RNase III domain-like 4.19e-48
Family RNase III catalytic domain-like 0.0000748
Further Details:      
 
Domain Number 2 Region: 122-234
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 3.46e-23
Family Double-stranded RNA-binding domain (dsRBD) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F4LTK9
Sequence length 238
Comment (tr|F4LTK9|F4LTK9_TEPAE) Ribonuclease III {ECO:0000256|HAMAP-Rule:MF_00104} KW=Complete proteome; Reference proteome OX=1209989 OS=Tepidanaerobacter acetatoxydans (strain DSM 21804 / JCM 16047 / Re1). GN=TEPIRE1_1303 OC=Thermoanaerobacteraceae; Tepidanaerobacter.
Sequence
MCIDEKRFQQLMILQENIGIQFNNLNTLNQAFIHPSLTNEKEKPYQENNQRLEFLGDAVL
ELAISEYLYRHYDFLTEGQMTKIRAFTVCESSLAQIARQLFLGDYLILSKGEENTGGREK
VSILADTLEALIGAIYIDKNYKTTYDFIIKNLEAIIFKAIQGEWGTDYKTDLQELLQKFD
EDKILYNVVNESGPDHDKLFCVEVVWKNKILGTGIGKSKKQAEQNAAKEALDRMNNEL
Download sequence
Identical sequences F4LTK9
WP_013778262.1.59919 WP_013778262.1.8343 gi|332799147|ref|YP_004460646.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]