SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F4MQV1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4MQV1
Domain Number 1 Region: 1-148
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 2.09e-36
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.00046
Further Details:      
 
Domain Number 2 Region: 165-259
Classification Level Classification E-value
Superfamily PTS system IIB component-like 1.92e-30
Family PTS system, Fructose specific IIB subunit-like 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F4MQV1
Sequence length 678
Comment (tr|F4MQV1|F4MQV1_MYCML) Phosphotransferase system PTS,fructose specific IIBC component {ECO:0000313|EMBL:CBW54484.1} KW=Complete proteome OX=862259 OS=Mycoplasma mycoides subsp. capri LC str. 95010. GN=MLC_7540 OC=Bacteria; Tenericutes; Mollicutes; Mycoplasmataceae; Mycoplasma.
Sequence
MHIKDLFNQNTSFFKQEFKTKTQIIDFLVSKLLEQKIISKKTVVLNAIKTREKLESTAIG
DGIAIPHTLNEAVLKPTVCFISLKNPIKWNNDDSQLVDLVFLIVTNDQNGDDHITAIAGL
SSKFLDSNVLSKLREIENFDELVEIFNDKKELKEEQINKNEFFDVVGITACPTGIAHTYL
ASDKLTEYAKSLNLSSKIETQGRRGIENKLTDEDIKNAKVIILAHDKAIEGMSRFNNHKV
IDTSTKDAIYNGKELISNFDTHPKLKEIKNIKADDSNIGELSLKKFKDFKGNLLGGVSRM
LPFVVAGGIILGIAFLLDFITGNGNAKGDFGTVNKVSGWFAAIGKTAMMMMVPMLGGYIA
YAIVGPQGLMPGVVAGLLADNTGGFAYGTIGSWSGLWKRILPDHLPTSSGFIGAMVGGYL
AAFIVFGLTIGMQKFKKPFHGVRDIVFIPILSLLGISLTMFVLNIPLGYLLYGIQLGLTY
MARNNLLIILGAIIGLMMCVDMGGPINKIAYVLGTASVAGTFGQDAIFTNIMAASMAGGM
IPPLGIALCTVLFKKVWTSKERDAAKANWLMGSFFISEGAIPFMVTDPKHISVSALSGGF
VTGLLVGAFKITLPAPHGGIFVFPLLNSELFTQHSVAKGMGIALFILAILIGTLVMTLIL
GFWKKVDINKGRLQLVQV
Download sequence
Identical sequences F4MQV1
gi|331703775|ref|YP_004400462.1| WP_013729855.1.3902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]