SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F4WAF4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F4WAF4
Domain Number 1 Region: 614-740
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.96e-36
Family Regulator of G-protein signaling, RGS 0.00011
Further Details:      
 
Domain Number 2 Region: 12-93
Classification Level Classification E-value
Superfamily PDZ domain-like 2.89e-20
Family PDZ domain 0.008
Further Details:      
 
Domain Number 3 Region: 928-1007
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.21e-18
Family Ras-binding domain, RBD 0.0068
Further Details:      
 
Domain Number 4 Region: 195-304
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000314
Family Phosphotyrosine-binding domain (PTB) 0.0092
Further Details:      
 
Domain Number 5 Region: 872-938
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000177
Family Ras-binding domain, RBD 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F4WAF4
Sequence length 1323
Comment (tr|F4WAF4|F4WAF4_ACREC) Regulator of G-protein signaling 12 {ECO:0000313|EMBL:EGI68837.1} KW=Complete proteome; Reference proteome OX=103372 OS=octospinosus echinatior). GN=G5I_02490 OC=Vespoidea; Formicidae; Myrmicinae; Acromyrmex.
Sequence
MHQNRRKKKRVNYGVRAVEVVRGAKGFGFTISGQQPCILSCIVQGSPAEGAGLRAGDYLV
AVNGHNVSKVPHDDVVQLIGNSKGILRLQIAENYYSDSSDEEGLATVRSKPKYAHKPRTA
SASALQLQCRAAKVVRDLQSGAMFHTVPGGLVMPDAKDQYNYSGLHYRWNMTSPLPLPPP
PASHKRDSEKIVHRTVVGYLGTIDIPNQLHPSSMMQVLRKCIKRLKAEKRNPTTVLLTIH
VANIKLTNSENRIIAEYPSYRIIFCNSFSEQDKQYFGILTKSMRNTDDIVSNSCHVFTIY
YKLIDHEVHSSACNVFGFMCTKSSELNVCQEFPDSCTSLIGAIQTLYISDCTNGENCTNP
YNEARIRLDTASPQPSNISTSTAHSSNSDSGIGFKDDYGSCSSKNLANDCERRRQYSNMQ
YRNASARLSKEPASEAAGHRLTVRATSEARLWSEELKFDSSKEMRHVAGSGEGTTTTCAG
TSAPAATARTMLASTSVGSLASVCTTALLDGIEDAAESSKVASTEGLKRLMDTTNKLSPK
VYCGQVTKSLVHSLEDINSSMEYARQPYCHSYSGKSDKPRPWGSLQEIRNFRSSASDNCI
YGSTESCDKNNDCKGVHTWANGFEKLLEDPKGLQTFAEFLKKEFSHENIYFWAACERYKD
TKDTTMRRRLACQIYQRHLSNTAAEPVNVDSHASGQITQELLDEAPADLFLQTQKQVFNL
MKFDSYPRFLRSELYRACLEAGSAVVDTEDCDLHLTSSPSVKLKKSHSDAEDRCRKSLLP
WNRKNRSKSKDRGESEYNKTPSRSETIYKSFTVIKRETEGNNNEDTVSISSSRSSLASWD
LALRQSFNKHSVSSYDGQTNEKKDARSKCTGLCRVILPDGSTTVVTTSQTESIKDVVTRL
LDKRALRYSNYDVLILATDEMVDTKCFSSVLAGQEVEVVPTKVLKVELPSRRIISIIAHK
GKTLKEVLRPLLNKYGFNLDLISIWSEGRCVPMDIMAINAPTRIIVMANEEDFQRELHTA
KYLDEVPHAQPTLDEITNKVFEELLVGKSRNKYQYSEGSCKSDDQRSEGSSILSSKFFLR
DSTIHGKKKAKSKCCNTSEKSNSNDCIHEGAPIKSQPPLIAKWRNGVKLQLPGRFDGDEL
YEGLKRAQRSRLEDQRGTEINFELPDFLKNKENGKPSDSNKMRRTRVVSANCEGTTKFYD
SSEDKQSSSGYEYSAHVTNGAASERFSALVNITEPLSKCLESSFNLDGDRTLMDGDQTII
ENGTDSPSKSPHSGSYGGTDLSHTKLSKPPPLPPKPKNLVVNVVKSGYITSPKTLQRPNH
VIE
Download sequence
Identical sequences F4WAF4
XP_011049121.1.86870 XP_011049122.1.86870 XP_011049123.1.86870 Aech_17809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]