SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F5H4X2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F5H4X2
Domain Number 1 Region: 19-78
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00000000619
Family Phosphate binding protein-like 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F5H4X2
Sequence length 81
Comment (tr|F5H4X2|F5H4X2_HUMAN) Porphobilinogen deaminase {ECO:0000313|Ensembl:ENSP00000444849} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=HMBS OC=Catarrhini; Hominidae; Homo.
Sequence
MSGNGNAAATAEENSPKMRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEISEFSGKE
WKLMGSPVPREERTQHFWLCL
Download sequence
Identical sequences F5H4X2
ENSP00000444849 ENSP00000459741 ENSP00000444849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]