SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F5HHI9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F5HHI9
Domain Number 1 Region: 30-226
Classification Level Classification E-value
Superfamily Ribosomal protein L1 4.06e-62
Family Ribosomal protein L1 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F5HHI9
Sequence length 226
Comment (tr|F5HHI9|F5HHI9_CRYNB) Ribosomal protein {ECO:0000256|RuleBase:RU000659} KW=Complete proteome OX=283643 OS=(Filobasidiella neoformans). GN=CNBE3910 OC=Cryptococcus neoformans species complex.
Sequence
MSKLQASSVRGSIRTVLDQSSLETHKEAGGKKRNFVETIELQIGLKNYDPQRDKRFSGTV
KLPHVPRPRMSLCILADAMDVDRAKQLDEELPFMTVEDLKKLNKNKKLVKKLAQKYDAFL
ASEALIKQIPRLLGPGLSKAGKFPTPVSHSEDLARKINDVRSTIKFQLKKVLCLGVAIGH
VDMTEDQVMQNVMLAINFLISLLKKQWQNIQSLTIKSTMGKPQRLF
Download sequence
Identical sequences F5HHI9 Q5KGE3
167.m03537 XP_571019.1.95466 XP_775117.1.65578 sgtc|cn05396 214684.CNE03920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]