SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F5HK56 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F5HK56
Domain Number 1 Region: 1131-1255
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.57e-35
Family Regulator of G-protein signaling, RGS 0.0001
Further Details:      
 
Domain Number 2 Region: 1457-1546
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.89e-25
Family Ras-binding domain, RBD 0.0056
Further Details:      
 
Domain Number 3 Region: 30-113
Classification Level Classification E-value
Superfamily PDZ domain-like 1.46e-19
Family PDZ domain 0.005
Further Details:      
 
Domain Number 4 Region: 256-381
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000574
Family Phosphotyrosine-binding domain (PTB) 0.012
Further Details:      
 
Domain Number 5 Region: 1401-1469
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000013
Family Ras-binding domain, RBD 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F5HK56
Sequence length 2303
Comment (tr|F5HK56|F5HK56_ANOGA) Regulator of G-protein signaling {ECO:0000313|VectorBase:AGAP002411-PB} KW=Complete proteome; Reference proteome OX=7165 OS=Anopheles gambiae (African malaria mosquito). GN=AgaP_AGAP002411 OC=Culicidae; Anophelinae; Anopheles.
Sequence
MHAGGVGGGGSGGGGGGGGGGAAHRRRKKRSNYGNRTVEVNRGSNGFGFTISGQQPCILS
CIVAGSPADLAGLRAGDFLISVNGLNVSKLPHESVVQLIGTTHGTIRMAIAENYYSDSSD
EDILFHGAQQQRTRPKYPHKTKFSRANTQGCSSGGGAPDRMAAAGSSSPIKSLLLGGPEN
GPEECVVNDTTPPGATTAYNVIHSPNASNSCDISNVSAMVRSVQLGGAVVDESVLVRPSG
SGQGPGQEGSLEYQAIVGYLGTIEMPKQIATSSKLQTVRSCIRKMRQEKRNPTTVLMTIL
PSCLNLTNTSNNLIAKYASARLSYVSSSSESDNRYFGLVTSAIYADGLMCDSADVLSHPR
KDVAISNSCHVFVIDGKLVEHEVHLEKAALFRIVCTKDPITNLCLEFPSNSEYVVNLIRS
MYSLKSPLKADGGPGGYGKPPVARSLNLDAAGAARGFPRNRSDPRLNPRGAGMDMDAHDM
LAANSPQPSNHSEITTTSSNSDSGIGFHNDCRNISDRILLVDFPGMLGPAQQRLLQQQQI
ANVRAHCRKSHPFLRPVGIINEIPPKMDPIRNIRSMGGAGCSADGAGPSGRSGLQISHGK
SKSADYSFPSTSSGMSPFVDRLTVRARPDPKPFSPDRSPSKENALNCMQDAEPSELMEQE
EAQDRWTCGGRTLDEQGNVVEERAIDVPPMQELFLDLERYNNDNVKNSLLAARSCDDMIL
SLGKKPPDGDEDINERMLLDAEAYERLKVKLSIDDLTLISSGCPGPAGAASDEVGRSAGN
SNHSNQHVFLQPLKPVKRSKKACTTHTAKAGNGKLAAIHGMAPTADENASVHGRRGGDKM
TAYKLSPKVFGLPRPISVSFENISTLSSSGVGGADGGARDSGAGNGGGGDKRLSVGGGEM
YYDGEDSVRHGANKSVLHGSGTPGRKSRATKRLSGGFSAIWGSLQELRSGSFGGAKGEDR
SKPVEHGKSVAPDVCYGEGELVAVAAKKKERERRLSGMKILEATYSEPDLRYDEVSVLGE
YCLGKTINHSASPFRRWGQSSLRSRSTEHRTPTNGSARRPSSLAASESDVYTKSIDDDHS
STKSGYNPYTGGGSAGGGVDTLSAESATIAAGPMGTAGTGGSGGTTTGPTGVASWGTSFE
KLLEDAAGLHTFSEFLKKEFSAENIYFWTACERYRQLTEREERAREAQAIFARHLESGCS
EPVNVDSIARNIALENLPQAEPTLFAAAQKQIFNLMKFDSYQRFIKSDLYRVCQEAEGKG
QGLPYPGEQLDPMLRTSATMLTASGTGTAASITKLKKSLSNAEDRRRKSLLPWHRKTRCK
SKDRGDSDTSKKDSKEKGGGSGGGGGGEKASGTTATGSSSNTLKLLSTNSTSDIHSSRSS
LASFDAAIGGKSCDPDDSRNTLCRVILSNGATTVVQTRSNETIKELVERLLEKRGIVYNA
YEAFLAGSTKPLDLDGPSVSLAGKEVNIDQRVVFKLNLPNRKMISVKSKAAKPLADVLRP
ILHKYNYELDEMKVVVHSTVDVCLDMTQPVTTVDGLCLYIRSANETPNVHPELGRPLAGA
RPVINTATHQQIVHHFQQQQQQQLLQLQNGPQSSAAGQQQHTFAVPSALPPSYAVATNSK
SQQLLGNGTAASATCNNNTVNQTQSRAKEQSEQQSKDDQQQQQQAGVGAGTRGQQELNSL
DEITNKVFDELRNGKTAFGGVVTAVGKGPGTVDVDCASDTSSTRRDRFRRRGSNAAPSES
GRGAKSKKCSTGGSEDGGESVNNLGIKKPIIAKLKAGVKLQIPTRSQNDELLEGLKRAQR
SRLEDQRGTEINFELPDFLKDKENFSTSSAAVSSSAGSIGPSAAPSSAAGPSKLTRSKPA
RRSEATTPTAEFVGGSLQQINKPQPAPRLSITGQQGRQNLSGPGSPVHAAVSDSHLNLST
QCNASPLPQDDPFHVHGGGSGTNGGSQSETSYADTTLVFTHARPYNGQALVTATPRTIPS
SSASQHYSGDHSSDSSSTADGPDLPNLACCEHHPHEMSPDSSSPPTHANHLHPLHYHPAG
AGASGANGAAGATPNGNTSTNNPYPLAVHYPSHHHHHPHLHPHHHPHGQHYHHHHHHTHN
GGGGYQTATSQPVANGSNATAAPGQDGQPNAISGGAPDSQKGPPPLPPKPKILPIKPSNW
GHPVAASYAPGPPGSAGAPSGASELLGGLSTNTLSTNGSMGGSVNGTGATVGGLSPSSST
VSSHHPNSNSNGVGVGTVVGSSNGIVSSTTHNDLSRGGREGNRQQRASSGNDGGSSNGSA
SAISVAVAQARNVYFDQGNSSFV
Download sequence
Identical sequences F5HK56
XP_003436115.1.40869 AGAP002411-PB|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]