SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6AGP9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6AGP9
Domain Number 1 Region: 3-151
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 6.18e-37
Family N-acetyl transferase, NAT 0.00000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F6AGP9
Sequence length 159
Comment (tr|F6AGP9|F6AGP9_PSEF1) Diamine N-acetyltransferase {ECO:0000313|EMBL:AEF20378.1} KW=Complete proteome; Reference proteome OX=743720 OS=Pseudomonas fulva (strain 12-X). GN=Psefu_0395 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MTLNIRPAVREDAALILRFITDLAIYEKAEHEVKTDVAGIENSLFGEGSTAHGLICELNG
EPMGYAVYFFNYSTWLGKHGLYLEDLYITPQQRGVGAGKALLRHLAKLAVARGCGRFEWS
VLDWNTPAIEFYDSIGAKPQNEWIGYRLTGEALTSFAAG
Download sequence
Identical sequences F6AGP9
WP_013789520.1.13474 gi|333898599|ref|YP_004472472.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]