SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6B8B2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6B8B2
Domain Number 1 Region: 171-359
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 5.75e-60
Family Methylesterase CheB, C-terminal domain 0.0000108
Further Details:      
 
Domain Number 2 Region: 4-123
Classification Level Classification E-value
Superfamily CheY-like 1.08e-29
Family CheY-related 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6B8B2
Sequence length 361
Comment (tr|F6B8B2|F6B8B2_DESCC) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome; Reference proteome OX=868595 OS=CO-1-SRB) (Desulfotomaculum carboxydivorans). GN=Desca_1831 OC=Desulfotomaculum.
Sequence
MPLVKVLVVDDSSLMRRLISRLLEEDKDIKVIGTAADGLEAIQQIKALRPDVVSMDVEMP
KLDGIATLRRVMLECPVPVVMLSAHTHEGARATMEALSAGAVDFVPKPGKSAELPIMVAD
LKTKIKVAARVSLRRIGRPTPVRPAARPIIKPAEPAPPVVSARKQPYCGKIDLVVIGCST
GGPAALQQIIPYLPANLPAGVVVVQHIPVGFSKSMAEHLDKKSAINVRHAEEGDEIKPGR
VLVCPAGYDLNFKPRGNGATVTLSNFGQPLAPGGFRPSVDRVMKSAAEVYGCRAMGVLLT
GMGKDGARGMLAIKQQGGLTIAEHESTCVVYGMPKAAVDLGAAQKIVPLPQIAQEIQAAF
Y
Download sequence
Identical sequences F6B8B2
WP_013810404.1.92302 gi|333924008|ref|YP_004497588.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]