SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6CGY7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6CGY7
Domain Number 1 Region: 4-47
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.000000000147
Family Omega transcriptional repressor 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) F6CGY7
Sequence length 55
Comment (tr|F6CGY7|F6CGY7_DESK7) Uncharacterized protein {ECO:0000313|EMBL:AEG14519.1} KW=Complete proteome; Reference proteome OX=760568 OS=Desulfotomaculum kuznetsovii (strain DSM 6115 / VKM B-1805 / 17). GN=Desku_0920 OC=Desulfotomaculum.
Sequence
MDSREVTKLAVRIPADLHRRIKILSVETGISLQDLVRQALEDYLRQHAGEQAPAK
Download sequence
Identical sequences F6CGY7
gi|333978375|ref|YP_004516320.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]