SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F6CH62 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F6CH62
Domain Number 1 Region: 3-427
Classification Level Classification E-value
Superfamily L-aspartase-like 1.54e-136
Family L-aspartase/fumarase 0.000000000271
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) F6CH62
Sequence length 430
Comment (tr|F6CH62|F6CH62_DESK7) Adenylosuccinase {ECO:0000256|RuleBase:RU361172} KW=Complete proteome; Reference proteome OX=760568 OS=Desulfotomaculum kuznetsovii (strain DSM 6115 / VKM B-1805 / 17). GN=Desku_1701 OC=Desulfotomaculum.
Sequence
MIERYTLPEMKAIWSQENKFRKWLEVEIYACEAMAEMGLIPEEAFKQIRERADFNVQRIE
EIEAVVNHDVIAFLTCVGEYVGDAAKYIHMGLTSSDVLDTALAVLMKEAGQQILRRLEEL
REVLLERAGEHRYTLMIGRTHGVHAEPITFGLKMLLWVAETERNIDRMKRAIDVISVGKI
SGAVGTYANIDPRVEAHVCRRLGLRPARISTQVLQRDRHAEFMTTLAVIGSSLDKFATEI
RSLQRTDILEVEEYFAQGQKGSSAMPHKRNPITAERISGLARILRGNALAALENVALWHE
RDISHSSVERVIIPDSTITLDYMLYKMTAIMKNLLVYPENMRKNLERTRGLLFSQRVLLA
LVEKGLSRERAYELVQRNAMRSWREGASFETLLKEDADITSVLSPQEIESLFNYNYHLRH
VDDIYRRFGL
Download sequence
Identical sequences F6CH62
gi|333979135|ref|YP_004517080.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]